KEGG   Methylorubrum populi: Mpop_3080
Entry
Mpop_3080         CDS       T00760                                 
Name
(GenBank) conjugal transfer protein precursor
Organism
mpo  Methylorubrum populi
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ACB81235
UniProt: B1ZGK1
Position
3304567..3305112
AA seq 181 aa
MTRRGYVIATCLAVMGTTLASLVPVPLRLIWNASASVPIGFYDLDPPGHLEVGDLVAVLP
DKPLADFLVERGYIGRDVPLMKRVMGLAGQRVCRIGNAITVDAIPLGRALDRDRRGRPLP
VWQGCRRLADGQIFLMNPDVSDSLDGRYFGPIPARGVIGKATPLYTDEGGDGRFVWRAAT
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atgacccgccgcggctatgtcatcgcgacgtgtctcgccgtcatggggacgacactggcg
tcgctcgttccggttccgcttcgcctgatctggaacgcttcggccagcgtgccgatcggc
ttctatgacctcgatcctccgggtcatctggaggtcggagatctggttgcggtattgccg
gacaagccgctcgccgatttcctggtcgagcgcggctatatcggtcgcgacgtgccgctg
atgaagcgcgttatggggcttgccggccagcgggtctgccgcatcggcaacgccatcacg
gtcgacgcgataccgcttgggcgtgcgctcgaccgcgaccggcgcggacgtccgctgccg
gtctggcagggctgtcgccgcctcgccgacggtcagattttcctcatgaaccccgatgtc
agcgacagcctggacggccgttacttcggtccgatcccggcgcgcggcgtcatcggcaag
gcgacgccgctctacaccgacgagggtggcgatggccgcttcgtctggcgtgccgccaca
cgctga

DBGET integrated database retrieval system