KEGG   Methylorubrum populi: Mpop_3084
Entry
Mpop_3084         CDS       T00760                                 

Definition
(GenBank) TRAG family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
mpo  Methylorubrum populi
Pathway
mpo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mpop_3084
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpo02044]
    Mpop_3084
Enzymes [BR:mpo01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Mpop_3084
Secretion system [BR:mpo02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Mpop_3084
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ACB81239
UniProt: B1ZGK5
Position
3308313..3310298
AA seq 661 aa
MSATKILWGQILTVSAIVLATTWGATEWVAWRLAFQPELGAPWFQLFGFPFYLPPAFFWW
WYGFDAYAPSIFVEGAWIAASGGFISVAVAIGMSVWRAREAKKVETYGSARWAEKEEVKA
AGLLNPDGVVLGRYDHDYLRHDGPEHVLCFAPTRSGKGVGLVVPSLLTWPGSAIVHDIKG
ENWQLTAGFRARHGRVLLFDPTNPKSSAYNPLLEVRRGEWEVRDVQNIADILVDPEGSLE
KRNHWEKTSHALLVGAILHVLYAEEEKTLAGVAAFLSDPKRPIESTLAAMMKTAHLGEAG
PHPVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAEVTRRCDWRITDIVTARHPT
TLYLVVPPSDINRTKPLIRLILNQVGRRLTEDLQAKAGRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGLKSFLIAQSLNQIEKAYGANNSILDNCHVRVSFATNDERTAKRVSDALGTA
TEMKAMRNYAGHRLSPWLGHLMVSRSETARQLLTPGEIMQLPPSDEIVMVAGTPPIRAKK
ARYYEDARFKERILPPPALVVPKQGRPDDWTALPLPLRPETAEPGSAAEASDEDPTASER
RQQPELNRLEPVEKKAPVENEFEIGLADEAEDDPVRNSRMNRLMQGVARQVSLDPGDGME
L
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgtccgcgacgaaaatcctctggggccaaatcctgaccgtctccgcgatcgtgctcgcc
acgacctggggcgcaacggaatgggtggcctggcggctcgccttccagccggagcttggg
gcaccgtggttccagctgttcggttttcccttctatttgccgcccgccttcttctggtgg
tggtatggctttgatgcctatgcgccgtcgatcttcgtcgagggcgcgtggatcgcggcg
tcaggcggattcatctcggtggccgtcgccatcggcatgtcggtctggcgcgcccgcgag
gccaagaaggtcgagacctacggctccgctcgctgggccgagaaggaagaagtgaaggcg
gcgggacttctcaatcccgatggcgtcgtgctcggccgctacgaccatgattatcttcgc
catgatggaccggagcatgtgctgtgcttcgcgccgacccgttcaggcaagggcgttggc
ctggtcgtcccctcgctgctgacctggcctgggtcggcgatcgtccacgacatcaagggc
gagaactggcaactcaccgccggctttcgcgcacgacatggccgcgtgctcctgttcgat
ccgaccaacccgaagtcctcggcctacaatccgctgctggaggtccgccgcggcgaatgg
gaggtgcgcgacgtccagaacatcgcggacatcctcgtcgatcccgaaggctcgctcgag
aagcgcaaccattgggaaaaaaccagccacgcgctgctggtcggtgcaatcctccatgtc
ctctacgctgaagaggaaaagactctcgctggcgtcgctgccttcctctccgatccgaag
cggccgatcgagtcgacgctcgccgcgatgatgaagacggcgcatctcggtgaagccggg
ccgcaccccgtcatcgccagcgccgcgcgcgagctgctcaacaaatccgacaacgagcga
tcgggcgtgctgtcgaccgccatgtccttcctcggcctctatcgcgatcctgtcgtggca
gaggtgacgcgccgctgcgactggcggatcaccgacatcgtgacggctaggcatccgacc
acgctctacctcgtcgtcccgccgtccgacatcaaccgcaccaagccgctcatccgcctg
atcctcaatcaggtcggccgccgcctgaccgaggatctccaggccaaggccggtcgccat
cggctgctgctgatgctcgacgaatttccggcgctgggccggctcgatttcttcgagtcc
gcgctggccttcatggcgggctatggcctgaagagtttcctgatcgcgcaaagcctcaat
cagatcgagaaagcctatggcgcgaacaactcgatcctcgacaactgccatgtgcgggtg
agcttcgcgaccaacgacgagcgcacggccaagcgcgtatcggacgcgctcggcaccgcg
accgagatgaaggcgatgcgaaactatgcggggcaccggctgtcgccgtggctcggacat
ctgatggtgtcgcgctcagaaacggcccgccagctgctcacccccggcgagatcatgcag
cttccgccgagcgatgagatcgtcatggtcgcgggcacgccgccgatccgggcgaaaaag
gcccgctactacgaggacgcgcgtttcaaggagcgcatcctgccgccgccagcactggtc
gtcccgaaacaggggcgtcccgacgattggaccgcgctgccgctcccacttcgacctgag
acggcagagccgggatcagcggcggaggccagcgatgaagatccaaccgcttccgaacgt
cgccagcaacccgaactcaatcgcttggagcctgtcgagaagaaggctccggtcgagaac
gagttcgagatcggccttgccgacgaggccgaagatgacccggtccgcaacagccggatg
aaccggctgatgcagggcgttgcccgtcaggtctcgctcgatccgggcgatggcatggaa
ctgtga

DBGET integrated database retrieval system