KEGG   Methylorubrum populi: Mpop_3092Help
Entry
Mpop_3092         CDS       T00760                                 

Definition
(GenBank) P-type conjugative transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
mpo  Methylorubrum populi
Pathway
mpo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mpop_3092
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpo02044]
    Mpop_3092
Secretion system [BR:mpo02044]
 Type IV secretion system
  Trb secretion system protein
   Mpop_3092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL
Motif
Other DBs
NCBI-ProteinID: ACB81247
UniProt: B1ZGL4
Position
3316153..3317505
Genome map
AA seq 450 aa AA seqDB search
MGGTGVIDHFLEVFTRYIDGGFGLLGGEVGFIATTLIVIDVTLAALFWSWGADDNIIARL
VKKTLFVGIFAYLISNWNNLARIIFESFAGLGLKASGTGFAVSDLMRPGKVAQTGLDAGR
PLLDSISNLMGYWSFFENFIQIACMFFAWALVLLAFFVLAIQLFVTLIEFKLTTLAGFVL
IPFGLFGKSAFMAERVLGNVISSGIKVLVLAVIIGIGSTLFSEFTAGFGGATPSIDDAMA
IVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAIGTGLAAGGMVAAGAATAGAVVSGGA
ALAGGAAAAARGGATLAGGATSAYSLGAAGQSGASAVASGLGNVASTGAKAAVSPLKRAA
GRAADSLTQSYRTGSHAATEIATGASGATASEASAGAASPASSATDGPPAWAKRMKRSQQ
LTHGVQAAAHAVRSGDSHGGGSSVNLSGSD
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggcaccggcgtcatcgaccatttcctcgaggtcttcacccgctacatcgatggc
ggcttcggcctgctcggcggcgaagtcggattcatcgccacaacgctgatcgtcatcgac
gtgacgcttgccgcgctgttctggtcgtggggcgccgatgacaacatcatcgccaggctg
gtcaaaaagacgctgttcgtcggcatcttcgcttacctgatctccaactggaacaatctc
gcccgtatcatcttcgagagcttcgccggccttggcctgaaagcctctggcacgggcttc
gcggtcagtgatctgatgcggcccggcaaggtcgcgcagaccggcctcgacgccggccgg
ccgttgctcgactcgatctcgaacctgatgggctactggtccttcttcgagaacttcatc
cagatcgcctgcatgttcttcgcctgggcgctggtgctgctcgccttcttcgtcctcgcg
atccagcttttcgtcaccctgatcgagttcaagctgacgacacttgccggcttcgtgctg
atcccgttcggcctgttcggcaaatcggcgttcatggccgagcgggtgctgggcaatgtg
atttccagcggcatcaaggttctcgttctcgccgtcatcatcggcatcggctcgacgctc
ttctccgagttcaccgctggttttggcggcgccacgccgtcgatcgacgacgcgatggcg
atcgtgctcgccgcgctttctcttcttggcctcggcatcttcggccccggcatcgccaac
ggcctcgtctcgggtggcccgcaactcggtgcgggcgccgccatcggaactggccttgcc
gccggcggcatggtcgcggccggcgcagcgaccgctggcgccgtcgtctccggtggcgcc
gcccttgctggcggcgcggccgccgccgcccgtggcggggcgacactcgcaggcggtgcg
accagcgcctacagccttggtgcggccgggcaatcaggcgcgtctgccgtcgcctctggt
ctcggcaatgtcgccagcacgggcgcgaaggccgccgtctcgccgctgaagcgcgccgct
ggtcgtgctgccgatagcctgacgcagagctaccggaccggcagccacgccgcgacggag
atcgccactggcgcatctggcgcaacggcgagcgaagcctccgctggagccgcctctccg
gcatcatccgccaccgacggtccaccggcctgggcgaagcgcatgaagcgttctcagcag
ctcacgcacggcgttcaggcggccgctcacgccgttcgcagcggcgacagccacggcggc
ggctcctccgtcaacctttccggaagcgactga

DBGET integrated database retrieval system