KEGG   Methylorubrum populi: Mpop_3412Help
Entry
Mpop_3412         CDS       T00760                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
mpo  Methylorubrum populi
Pathway
mpo00471  D-Glutamine and D-glutamate metabolism
mpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mpop_3412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mpo01011]
    Mpop_3412
Enzymes [BR:mpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Mpop_3412
Peptidoglycan biosynthesis and degradation proteins [BR:mpo01011]
 Precursor biosynthesis
  Racemase
   Mpop_3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF1919
Motif
Other DBs
NCBI-ProteinID: ACB81563
UniProt: B1ZJS8
Position
complement(3638276..3639136)
Genome map
AA seq 286 aa AA seqDB search
MAGATLSATMPAQNAQPVILVFDSGLGGLTVLEQVRRARPDAAYVYAADDAAFPYGAFTE
ERLVSRVIAVMERLLARHAPDLVVIACNTASTLVLPALRQRFVTPFVGVVPPIKPAAALT
RSRLISLLATPGTVARAYTHDLVRNFAAHCAVTLVGSKNLAGYAEAEMAGEPVSDAALLA
EIAPCFVEQADGRRTDVVCLSCTHYPLLLPRFERLAPWPVTWIDPAPAIARRVIQLLGEM
PAQAPEAPPARAVFTGGAGLTPALGHSLERRGLTETMVEAMPLAVG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcgaccctttcggccacgatgccggcgcagaacgcgcagccggtcattctc
gtcttcgattccgggcttggcggcctcaccgtgctggagcaggtgcgccgcgcccggccg
gacgcggcctatgtctacgcggcggacgacgcggcctttccctacggcgccttcaccgag
gagcggctggtgtcgcgggtgatcgcggtgatggagcggctgctggcccgccacgccccc
gacctcgtggtgatcgcctgcaacacggcctcgaccctggtgctgccggccctgcgccag
cgcttcgtcacgcccttcgtcggcgtggtgccgccgatcaagccggccgccgcgctcacg
cgctcccgcctcatctccctgctcgcgacccccggcacggtggcgcgggcctacacccac
gatctcgtgcggaacttcgcggcacattgcgccgtgaccctggtgggctccaagaacctc
gcgggctacgccgaggccgagatggcgggcgagccggtgtcggacgccgcactcctggcc
gagatcgcgccctgcttcgtggagcaggcggatggccggcgcaccgatgtcgtgtgcctc
tcctgcacccactacccgctgctgctgccccgcttcgagcgccttgcgccctggccggtc
acgtggatcgatccggccccggccatcgcccgtcgcgtgatccagcttctcggcgagatg
ccggcgcaggccccggaagcgccgcctgcccgagccgtgttcaccggaggggctgggctc
accccggcgctcggccactcgctggagcggcggggtctcaccgagacgatggtggaggcg
atgccgctggcggtgggttga

DBGET integrated database retrieval system