KEGG   Methylorubrum populi: Mpop_3440Help
Entry
Mpop_3440         CDS       T00760                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpo  Methylorubrum populi
Pathway
mpo00071  Fatty acid degradation
mpo00072  Synthesis and degradation of ketone bodies
mpo00280  Valine, leucine and isoleucine degradation
mpo00310  Lysine degradation
mpo00362  Benzoate degradation
mpo00380  Tryptophan metabolism
mpo00620  Pyruvate metabolism
mpo00630  Glyoxylate and dicarboxylate metabolism
mpo00640  Propanoate metabolism
mpo00650  Butanoate metabolism
mpo00900  Terpenoid backbone biosynthesis
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
mpo01212  Fatty acid metabolism
mpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpop_3440
   00630 Glyoxylate and dicarboxylate metabolism
    Mpop_3440
   00640 Propanoate metabolism
    Mpop_3440
   00650 Butanoate metabolism
    Mpop_3440
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mpop_3440
   00072 Synthesis and degradation of ketone bodies
    Mpop_3440
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mpop_3440
   00310 Lysine degradation
    Mpop_3440
   00380 Tryptophan metabolism
    Mpop_3440
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mpop_3440
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mpop_3440
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mpop_3440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpo04147]
    Mpop_3440
Enzymes [BR:mpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mpop_3440
Exosome [BR:mpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mpop_3440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACB81591
UniProt: B1ZKM1
Position
complement(3667325..3668533)
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKPDGSLHEVTALRLAETALRALKDRNNLDTRAVDDVVLGCVDP
VGEAGGDIARAAALVADYGTHVPGVQINRFCASGLDAINFAAAQVMAGQHDLTVGGGVES
MSRIGLGASGGAWPVDPAIAVKSYFMPQGVSADLIATKYGFSRDDCDAYAVESQKRSAKS
WDEGLFRNSVVPVRDINGITLLDRDEHMRPTTDMQSLASLKASFVQMGQMGGFDAVAVDA
HPDVEAVEHVHHAGNSSGIVDGAAAVLIGSREAGDAAGLRPRARIRAFANIGSDPALMLT
GPVDVTKKVLARAGMDLSDIDLFEINEAFASVVLRFHQAFDLDPARVNVNGGAIAMGHPL
GATGAMILGTVLDELERTGKERALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctacatctacgatcacgtccgcaccccacgcggccgcggcaagccggac
ggttcgctgcacgaggtgacggcgctgcgcctcgccgagacggctttgcgcgccctgaag
gaccgcaacaatctcgacacccgggccgtggacgacgtggtgctcggctgtgtcgatccc
gtcggcgaggccggcggcgacatcgcccgcgcggcggcgctcgtggccgattacggcact
catgtccccggcgtgcagatcaaccgcttctgcgcgtcgggcctcgacgccatcaacttc
gccgcggcgcaggtcatggccggccagcacgacctcacggtgggcggcggcgtcgaatcg
atgagccgcatcggcctcggcgcctccggcggcgcctggccggtcgatccggcgatcgcc
gtcaaatcctacttcatgccgcagggcgtctcggccgacctcatcgccaccaagtacggc
ttctcccgcgacgattgcgacgcctacgccgtcgagtcgcagaagcgctcggccaagtcg
tgggacgagggcctgttccggaattccgtcgtgccggtgcgcgacatcaacggcatcacc
ctgcttgaccgcgacgagcacatgcggccgaccaccgacatgcagtcgctggcgagcctg
aaggcctccttcgtgcagatgggccagatgggcggcttcgacgcggtggccgtcgatgcc
catccggatgtcgaggcggtggagcatgtccaccacgccggcaattcctccgggatcgtc
gacggggcggccgcggtgctgatcggctcgcgcgaggccggcgatgcggcgggcctccgg
ccgcgggcccgcatccgggcgttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgatgtcacgaagaaggtgctggcgcgggccgggatggacctgtccgacatc
gacctgttcgagatcaacgaggccttcgcctccgtggtcctgcgcttccaccaggccttc
gacctcgacccggcgcgggtgaacgtcaacggcggcgccatcgccatgggccacccgctc
ggcgccaccggggcaatgatcctcggcaccgtgctcgacgagttggagcgcaccggcaag
gaacgggcgctcgtcaccctgtgcatcggcgccggtatgggcaccgccacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system