KEGG   Methylobacterium populi: Mpop_3472Help
Entry
Mpop_3472         CDS       T00760                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpo  Methylobacterium populi
Pathway
mpo00040  Pentose and glucuronate interconversions
mpo00052  Galactose metabolism
mpo00500  Starch and sucrose metabolism
mpo00520  Amino sugar and nucleotide sugar metabolism
mpo01100  Metabolic pathways
mpo01130  Biosynthesis of antibiotics
Module
mpo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mpop_3472
   00052 Galactose metabolism
    Mpop_3472
   00500 Starch and sucrose metabolism
    Mpop_3472
   00520 Amino sugar and nucleotide sugar metabolism
    Mpop_3472
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mpop_3472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACB81622
UniProt: B1ZKQ2
Position
3706017..3706883
Genome map
AA seq 288 aa AA seqDB search
MKRIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIFVTGRG
KAVIEDHFDIAFELDHTLQARGKTAAYEELKKDLPKAGQTSFTRQQAPLGLGHAVWCARE
IVGDEPFAVLLPDMLSRGCMGQMLAAYEQHGGNIIAVEEVKPEETHQYGIVGVGETFGQT
FEITGMVEKPKQGTAPSNFIISGRYILQPEIFSILERGETGAGGEIQLTDAMIRLAEQQK
FYGMRYDGRTYDTGSKIGFLTANLAYGLERPELADALKAEIRALLGDV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcgcaaggccgtccttcccgtcgcgggcctcggcacgcgcttcctgccg
gcgaccaaggccgtgccgaaggaaatgctcacggtcgtcgatcgaccggtcgtccagcac
gtcgtcgacgaggctcgtgaagccggcatcgagcacttcatcttcgtcaccggccgcggc
aaggccgtgatcgaggaccatttcgacatcgcgttcgaactcgaccacacgctgcaggcg
cgcggcaagacggcggcctacgaggagctgaagaaggacctgcccaaggccggccagacg
agcttcacccggcagcaggccccgctcggcctcggccacgcggtctggtgcgcccgcgag
atcgtcggcgacgagcccttcgcagtgctgctgccggacatgctgagccgcggctgcatg
ggccagatgctcgcggcctacgagcagcacggcggcaacatcatcgcggtggaggaggtg
aagcccgaggagacgcaccagtacggcatcgtcggcgtaggcgagaccttcggccagacc
ttcgagatcaccggcatggtggagaagcccaagcagggcaccgcgccctcgaacttcatc
atctccggccgctacatcctccagcccgagatcttctccatcctggagcgcggcgagacc
ggggccggcggcgagatccagctcaccgacgcgatgatccggctggccgagcagcagaag
ttctacggcatgcgctacgacgggcgcacctacgacaccggctccaagatcggcttcctc
accgccaatctcgcctacggactggagcggccggagctggccgacgccttgaaggcggag
atccgcgcccttctcggcgacgtctga

DBGET integrated database retrieval system