KEGG   Methylobacterium populi: Mpop_3512Help
Entry
Mpop_3512         CDS       T00760                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mpo  Methylobacterium populi
Pathway
mpo00240  Pyrimidine metabolism
mpo00250  Alanine, aspartate and glutamate metabolism
mpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mpop_3512
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mpop_3512
Enzymes [BR:mpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mpop_3512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACB81662
UniProt: B1ZLL0
Position
3744595..3745542
Genome map
AA seq 315 aa AA seqDB search
MTAQTAPAFPHRHLLGIEGLSRPDIESLLERADAAVALSRQVEKKRTTLRGRTQINLFFE
PSTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLIDTAATLNAMRPDIIVVRHHAAGA
VHLLARKVDCAVVNAGDGAHEHPTQALLDALTIRRNKGGIEGLTVAICGDVLHSRVARSN
IILLQALGARVRVIGPSTLLPTGIERFGVEVFTNMREGLKGCDIVMMLRLQRERMNGSFV
PSVKEYFRYYGLDGDKLALAKPDALVMHPGPMNRGVEIASDIADGAQSLIREQVEMGVAV
RMAVLEALATHLPNG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagaccgcacccgccttcccgcaccggcacctgctcggcatcgaaggcctg
agccgtccggacatcgagtcgctcctggagcgcgccgacgccgccgtcgccctgtcgcgg
caggtggagaagaagcgcaccaccttgcgcgggcgcacccagatcaacctgttcttcgag
ccctcgacccggacgcaatcctcgttcgagctggccggcaagcggctcggcgccgacgtg
atgaacatgtcggtggcctcgtcctcggtgaagaagggcgagaccctgatcgacaccgcc
gcgaccctgaacgccatgcgccccgacatcatcgtcgtgcgccaccatgcggcgggcgcg
gtgcatctgctggcgcgcaaggtcgattgcgccgtggtcaatgcgggcgacggcgcccac
gagcacccgactcaggcgctgctcgacgcgctcaccatccgccgcaacaagggcggcatc
gaggggctcacggtcgcgatctgcggcgacgtgctgcattcgcgggtcgcgcgctccaac
atcatcctgctccaggcgctcggtgcccgggtgcgggtgatcggcccctcgacgctgctg
cccaccggcatcgagcgcttcggcgtcgaggtgttcaccaacatgcgggaggggctgaag
ggctgcgacatcgtgatgatgctgcggcttcagcgcgagcgcatgaacggctctttcgtc
ccctcggtgaaggagtatttccgctattatggcctcgacggcgacaagctggcgctggcc
aagcccgacgcgctggtgatgcatcccggcccgatgaaccgcggcgtcgagatcgcctcc
gacatcgccgacggagcgcaatcgctgatccgcgagcaggtcgagatgggcgtcgccgtg
cggatggccgtgctggaagcgctggcgacccacctgccgaacggttag

DBGET integrated database retrieval system