KEGG   Methylorubrum populi: Mpop_3518Help
Entry
Mpop_3518         CDS       T00760                                 

Definition
(GenBank) ThiJ/PfpI domain protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
mpo  Methylorubrum populi
Pathway
mpo00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Mpop_3518
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mpo01002]
    Mpop_3518
Enzymes [BR:mpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     Mpop_3518
Peptidases [BR:mpo01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   Mpop_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ACB81668
UniProt: B1ZLL6
Position
3751280..3751960
Genome map
AA seq 226 aa AA seqDB search
MTIEIGFLVFPRVQQLDLTGPYEVLAMVPDTRVHLVAKDLTPVASATGLVLTPTITFAEC
PALDVICVPGGSGVNPLMEDAETLDFLRRQAERARTVTSVCTGALVLGAAGLLRGRRATT
HWAAHDLLGPLGAIPTQGRVVRDGNLITGGGVTAGIDFGLTLAAELADEATARAIQLHLE
YAPAPPFEAGRPETAGPETLAAARERLSATRREREAIVARLTQAQG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgagatcggcttcctcgtcttcccccgggtgcagcagctcgacctcaccggc
ccctacgaggtgttggccatggtgccggacacccgcgtgcatctcgtcgcgaaagacctg
accccggtcgcgagcgccaccggcctcgtgctgacgcccacgatcaccttcgccgaatgc
cccgctctcgacgtgatctgcgtgccgggcggctcgggcgtgaacccgctgatggaggat
gccgagaccctcgacttcctgcgccgacaggcggagcgcgcccgcaccgtcacctcggtc
tgcaccggcgccctggtgctcggcgccgcgggcctcctgcggggcaggcgcgccaccacc
cattgggcggcgcacgacctgctcggccccctcggggcgatcccgacgcagggacgcgtg
gtgcgcgacggcaacctgatcaccggcggcggcgtgacggcgggcatcgatttcggcctg
acgcttgcggcggaactcgccgacgaggccaccgcgcgggcgatccagctccatctggaa
tacgccccggccccacccttcgaggccggccggcccgagaccgcgggccccgagacgctg
gccgccgcccgcgagcggctgtcggcgacgcgccgggagcgggaggcgatcgtggcccgg
ctcacgcaagcgcagggttag

DBGET integrated database retrieval system