KEGG   Methylorubrum populi: Mpop_4703Help
Entry
Mpop_4703         CDS       T00760                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mpo  Methylorubrum populi
Pathway
mpo00450  Selenocompound metabolism
mpo00970  Aminoacyl-tRNA biosynthesis
mpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Mpop_4703
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mpop_4703
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpo01007]
    Mpop_4703
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpo03016]
    Mpop_4703
Enzymes [BR:mpo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Mpop_4703
Amino acid related enzymes [BR:mpo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Mpop_4703
Transfer RNA biogenesis [BR:mpo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mpop_4703
 Prokaryotic type
   Other AARSs
    Mpop_4703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACB82799
UniProt: B1ZIW0
Position
complement(5021486..5023054)
Genome map
AA seq 522 aa AA seqDB search
MSASEKANEPFLITTAISYPNGAPHIGHAYEVIATDAIARFHRLDGREVLFTTGTDEHGL
KIQQTAAKAGVTPRAFVDDMAGRFKAVADRLDCAYDRFIRTTEPDHYAAAQELWRRMEAN
GDIYLAKYAGWYSVRDEAYYDEAETVLAPDGSRRSAKTDTPVEWMEEENYLFRLSKYQEP
LLKLYAEQPDFLAPETRMNEVASFVRSGLKDLSISRTTFDWGVPVPDRPGHVMYVWVDAL
TNYLTVTGFPDAGAPNARFWPASLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFF
LSRGEKMSKSLGNVVDPLDLVGTYGVDPVRYFLLREAPFGGDGNYDHEAIINRINADLAN
DLGNLAQRSLSMIAKNCDGAVPEPGDFTEADARLLAAAAALPEKARGLMQNLALHAILAE
IWAVVGEANRYFASEEPWKLRKSDPARMNTVLYVTVETLRRVGLMVQPFVPTAGAALLDL
LAVPVDRRSFAFAGEDHRLQGGTALPAPAPIFPRFERPEATA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgagcgagaaggcgaacgagcccttcctcatcaccacggcgatctcctacccc
aacggcgcgccgcatatcggccacgcctacgaggtgatcgccaccgacgccatcgcccgc
ttccaccgcctcgacgggcgcgaggtgctgttcaccaccggcaccgacgagcacggcctc
aagatccagcagacggcggccaaggccggggtgacgccgcgcgccttcgtcgacgacatg
gccgggcgcttcaaggcggtggccgaccggctcgactgcgcctacgaccgcttcatccgc
accacggagcccgaccattacgctgcggcgcaggagctatggcggcgcatggaggccaac
ggcgacatctacctcgccaagtatgccggctggtactcggtgcgcgacgaggcctattac
gacgaggccgagaccgtgctcgcgcccgacggcagccgccgctcggccaagaccgacacg
ccggtcgagtggatggaggaggagaactacctcttccgcctgtccaagtaccaggaaccc
ctgctcaagctctacgcggagcagccggacttcctggcgcctgagacgcggatgaacgag
gtcgcgagcttcgtgcgctccggcctcaaggatctctcgatcagccgcaccaccttcgac
tggggcgtgccggtgcccgaccggccgggccacgtcatgtatgtctgggtcgatgcgctc
accaactacctgacggtgacgggcttccccgatgcgggggcgcccaacgcccggttctgg
ccggcgtcgctccacatcatcggcaaggacatcgtccgcttccacgcggtctactggccg
gccttcctgatgtcggcggggctgccgctgcccaagcgcgtgttcggccacggcttcttc
ctgagccgcggcgagaagatgtcgaagtcgctcggcaacgtggtcgacccgctcgatctc
gtcggcacctacggcgtcgatccggtgcgctacttcctgctgcgcgaggcgcccttcggc
ggagacggcaactacgaccacgaggcgatcatcaaccgcatcaacgcggacctcgccaac
gatctcggcaatctcgcccagcgctcgctgtcgatgatcgccaagaactgcgacggcgcc
gtgcccgagccgggtgacttcaccgaggccgacgcacgcctgctcgccgccgccgccgcg
ctgccggagaaggcgagggggctgatgcagaacctcgccctgcacgcgatcctggccgag
atctgggccgtggtcggcgaggccaaccgctacttcgcctccgaggagccgtggaagctg
cgcaagagcgatccggcgcgcatgaacacggtgctctacgtcacggtcgagacgctgcgc
cgggtcggcctgatggtgcagcccttcgtgccgacggcgggcgcggctctgctcgacctg
ctcgccgtgccggtggaccggcgcagcttcgccttcgccggcgaggaccaccgcctgcag
ggcggcacggcgctgcccgccccggccccgatcttcccccgcttcgagcggccggaggcg
acggcctga

DBGET integrated database retrieval system