KEGG   Methylobacterium populi: Mpop_4758Help
Entry
Mpop_4758         CDS       T00760                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mpo  Methylobacterium populi
Pathway
mpo00860  Porphyrin and chlorophyll metabolism
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpop_4758
Enzymes [BR:mpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mpop_4758
Exosome [BR:mpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mpop_4758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACB82854
UniProt: B1ZJT8
Position
5083363..5084418
Genome map
AA seq 351 aa AA seqDB search
MSDATPRPLAIETAREAAPGAGPLSLTQRPRRNRKADWSRRLVREHSLTVDDLIWPLFVI
EGERRREPIASMPGVERLSVDEIVREAERAARLGIPLVSFFPYTEPSLRDPTGSEALNRE
NLVCRAVRAVKRAVPEIGVMTDVALDPYTSHGHDGLIEDGAILNDETVAVLVEQSLIQAE
AGTDIIAPSDMMDGRVGAIRTGLDRAGFRDVQIMAYAAKYASAFYGPFRDAIGTKAALVG
DKRTYQMDPGNGTEALREVALDLAEGADSVMVKPGLPYLDIITRVKTEFGVPTFAYQVSG
EYAMIEAAARNGWLDGERAMTESLLAFKRAGADGVLTYYAPRVAERLRAGA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgccaccccgcgcccgctcgccatcgagaccgcgcgcgaagccgcccccggc
gcggggccgctgagcctgacccagcgcccgcgccgcaaccgcaaggcggactggtcgcgc
cgcctcgtgcgcgagcacagcctgaccgtcgacgacctgatctggccgctcttcgtgatc
gagggcgagcggcggcgcgagccgatcgcttccatgcccggcgtcgagcgcctgagcgtg
gacgagatcgtgcgcgaggccgaacgcgccgcccggctcggcatccccctggtctcgttc
ttcccctataccgagccgtcgctgcgcgaccccaccggctccgaggcgctcaatcgcgaa
aacctcgtctgccgggcggtgcgggcggtgaagcgggcggtgcccgagatcggcgtgatg
accgacgtggccctcgacccctataccagccacggccatgacggcctgatcgaggacggc
gcgatcctcaacgacgagaccgtggcggtgctggtcgagcagagcctgatccaggccgag
gccggcaccgacatcatcgcaccctccgacatgatggacgggcgcgtcggcgcgatccgc
accggcctcgaccgggcgggattccgtgatgtccagatcatggcctacgccgccaaatac
gccagcgccttctacggtccgttccgcgacgccatcggcaccaaggcggcgctggtcggc
gacaagcgcacctaccagatggaccccggcaacgggacggaagccctgcgcgaggtcgcc
ctcgacctggccgagggcgccgactcggtgatggtgaagccgggcctgccctatctcgac
atcatcacccgggtgaagaccgagttcggcgtgccgaccttcgcctaccaagtgtcgggc
gagtacgcgatgatcgaggccgccgcccgcaacggctggctcgacggcgagcgcgcgatg
accgagagcctgctcgccttcaagcgcgcgggcgccgacggggtgctgacctattacgcc
ccccgcgtcgccgagcgcctgcgcgcgggcgcctga

DBGET integrated database retrieval system