KEGG   Methylorubrum populi: Mpop_5262Help
Entry
Mpop_5262         CDS       T00760                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mpo  Methylorubrum populi
Pathway
mpo00860  Porphyrin and chlorophyll metabolism
mpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpop_5262
Enzymes [BR:mpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Mpop_5262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ACB83356
UniProt: B1Z9X0
Position
5627621..5629087
Genome map
AA seq 488 aa AA seqDB search
MTRALMIQGTGSDVGKSLLVAGLARAFTRRGLRVRPFKPQNMSNNAAVTADGGEIGRAQA
LQARAARVAPSVHMNPVLLKPQSEVGAQVVVQGRMIGTARARDYQAWKPRLMESVLDSFE
RLRADSDLVLVEGAGSPAEVNLRRGDIANMGFARATDTPVVIVGDIDRGGVIASLVGTQA
VMEPDDAAMIRGFIVNRFRGDPTLFADGMALIAERTGWTPFGLVPFFPEAGRLPPEDAVA
LDVAGAGRDGSVPLIAVLRFPHIANFDDLDPLRQEPGVSVAFVPAGEPIPAEADLIVLPG
SKTTIDDLDFLRAQGWDIDIRAHLRRGRRVLGLCGGYQMLGRAIADPQGIEGAPRALPGL
GLLDVETVMTAEKRLVAVTGTTLADDEPFSGYEMHVGDTTGPDAAHPLLRFADGRADGAV
SADGLVAGTYVHGLFANDRQRAAWLARLGAAPGLTNYEAGIEAVLDRFADHLEAHLDCDG
LLRLCRPL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgccctgatgatccaggggaccgggtccgatgttggcaagtcgctgctggtg
gcgggccttgcccgcgccttcacccggcgcggcctgagggtacgtccgttcaagccgcag
aacatgtcgaacaacgccgccgtcaccgccgatggcggcgagatcgggcgcgcccaggcc
ctccaggcccgcgccgcgcgggtcgcgccgtccgtccacatgaacccggtgctgctcaag
ccccagagcgaggttggcgcgcaggtggtggtgcaagggcggatgatcggcacggcccgg
gcgcgggactatcaggcctggaagccgcgcctgatggaatccgtcctcgatagtttcgag
cgcctgcgcgcggactccgacctcgtgctcgtggaaggtgccggctcgccggccgaggtg
aacctgcgcaggggcgacatcgccaatatgggctttgcccgcgcgacggacacgcccgtg
gtgatcgtcggcgacatcgaccgcggcggcgtcatcgccagcctcgtcggcacgcaggcc
gtaatggagcccgacgacgcggcgatgatccgcggcttcatcgtcaaccgcttccgcggc
gacccgaccctgttcgccgacggcatggccctgatcgcggagcggaccggctggacgccg
ttcggcctcgtgccgttcttccccgaggccggtcgcctgccgccggaggatgcggtggcg
ctcgacgtagccggcgctggccgcgacggatcggtgccgttgatcgcggtcctgcgcttc
ccccacattgccaatttcgacgacctcgacccgctgcggcaggagcccggcgtctccgtc
gccttcgtccccgccggcgagccgatcccggccgaggccgacctgatcgtccttccgggt
tcgaagaccacgatcgacgacctcgatttcctgcgggcgcagggctgggacatcgacatc
cgtgcgcatctgcgccgcggccggcgggtgctcggcctgtgcggcggctatcagatgctc
ggacgcgccatcgccgatccgcaggggatcgagggtgcgccgcgcgcgctcccgggcctc
ggcctgctcgatgtcgagacggtgatgacggccgagaaacgcctcgtcgccgtcaccggc
acgacgctggccgatgacgagcccttctccggctacgagatgcatgtcggcgacacgacc
ggcccggacgcggcccatccgctcctgcgtttcgccgacggccgggccgacggtgcggtc
tcggccgacgggctcgtggccggcacctatgtccacggcctgttcgcgaacgaccggcag
cgcgcggcctggctcgcccggctcggcgcggcgccggggctgaccaactacgaggccggg
atcgaggcggtgctcgaccgattcgccgaccacctcgaagcgcatctggattgcgacggg
ctgctccgcctctgccggcctctctga

DBGET integrated database retrieval system