KEGG   Micromonas pusilla: MICPUCDRAFT_20618Help
Entry
MICPUCDRAFT_20618 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mpp  Micromonas pusilla
Pathway
mpp00970  Aminoacyl-tRNA biosynthesis
mpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MICPUCDRAFT_20618
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mpp03029]
    MICPUCDRAFT_20618
Enzymes [BR:mpp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MICPUCDRAFT_20618
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MICPUCDRAFT_20618
Mitochondrial biogenesis [BR:mpp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MICPUCDRAFT_20618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-GeneID: 9687181
NCBI-ProteinID: XP_003061503
JGI: 20618
UniProt: C1N138
AA seq 580 aa AA seqDB search
MSRLARDAAAALRRGLLATRRDATAAASTSAATVSRGRRARAVSTTTTTSSSSSSSAAVD
ARDADADAADEDAWETVVGLELHAQVAADTKLFSGAARQYGARVNANVAPFDAALPGSLP
SVNARAVELATRLGVALGGEIHRASRFERKHYAYPDLPHGYQITQRRDPIVRGGRIDVDV
GAGATRRLRIEQIQLEMDTGKSVNKTGGGGGGTTTTTIDLNRAGCALVEIVTRPDLRGGE
EAAAAAEAFQKTLRFLGVGDANMEEGSLRVDVNVSVRRRGDGGDDGAALGERCEVKNLNS
FRSIASAVRFEARRHRELIARGENVERETRSFDPANGETAPLRREQTLDYRFTPEPDVPP
IVLSDEYVAAIARDTPELPDVAIRRLADVRGDHALPLKLATAVATHASTARYYEAALSAA
KRSAAPRDVDVDAAAVARFVVGELTGEVKRASVAGRVEPLLGLPARLSPERVGELLAAVA
AGETTARMAKARPMGWRDVVDALFPPVGDGEGGGEGGGDAAVEAMCRDIVCGMPEEVALF
KAGKTRLMGKFVGEAMRRTNGRADPKVVSRALTRALSEEV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtctcgcgcgcgacgccgcggcggcgctccggcgaggtctcctcgcgacgcgc
cgcgacgcgacggccgcggcgtccacgtccgcggcgacggtctcgcgcggtcgtcgcgcg
cgcgcggtgtcgacgacgacgacgacgtcgtcgtcgtcgtcgtcgtcggccgccgtcgac
gcccgcgacgccgacgccgacgccgcggacgaggacgcctgggagaccgtcgtcggcctg
gagctccacgcgcaggtcgccgcggacacgaagctgttctccggcgccgcgcgacagtac
ggagcgcgcgtgaacgcgaacgtcgcgcccttcgacgccgcgctccccggatcgctcccg
agcgtcaacgcgcgcgcggtggagctcgcgacgagactgggcgtcgcgctcggcggggag
attcatcgcgcgtcgcggttcgagaggaagcactacgcgtacccggacctgccgcacggg
tatcagatcacgcaacggcgcgatccgatcgtccgcggcgggcgcatcgacgtcgacgtc
ggcgccggcgcgacgcggcggctgcgtatcgagcagatacagctcgagatggacaccggg
aagagcgtcaacaaaacgggcggcggcggcggcgggacgacgacgacgacgatcgacctg
aaccgcgccgggtgcgcgctcgtggagatcgtcacgagacctgatctgagagggggcgag
gaggccgcggccgccgcggaggcgtttcagaagacgctgcggttcttgggcgtcggcgac
gcgaacatggaggaggggtccctacgcgtggacgtcaacgtcagcgtgcgaaggcgaggc
gacggtggcgacgacggcgccgcgctcggcgagcggtgcgaggtgaaaaacttgaacagc
ttcagatcgatcgcgtccgcggtgcgcttcgaagccaggcgtcatcgcgagctgatcgcg
cgcggggagaatgtcgaacgcgagacgcggtcgttcgacccggcgaacggcgaaaccgcg
ccgctcaggcgcgagcagacgttggactatcggttcacgcccgagccggacgtgccgccg
atagtgttgtccgacgagtacgtggcggcgatcgcgcgcgacaccccggagcttcccgac
gtcgcgattcgtcggctcgcggacgtccgcggcgaccacgcgctgcctctgaagctcgcg
accgcggtcgcgacgcacgcgtcgacggcgaggtattacgaagccgcgctatcggcggcg
aagagaagcgccgcgccgcgcgacgtcgacgtcgacgccgccgccgtcgctcggttcgtc
gtcggcgagctcacgggcgaggtgaagcgagcgtccgtggccgggcgcgtggagccgctc
ctcggactccccgcgcgtctgagccccgagcgcgtcggcgagctcctcgcggcggtcgcc
gccggggagacgacggcgcggatggccaaggcgcgtcctatggggtggcgcgacgtcgtc
gacgcgctgttccctcccgtcggcgacggcgaaggcggcggcgaaggcggcggcgacgcg
gccgtggaggcgatgtgccgagacatcgtatgcgggatgcccgaggaggtggcgttattc
aaggcgggaaagacgcggctcatggggaagttcgtcggcgaggcgatgcgacggaccaac
ggtcgcgcggatccgaaggtcgtgtcgcgagcgttgacgcgcgcgctgtcggaggaggtc
tag

DBGET integrated database retrieval system