KEGG   Micromonas pusilla: MICPUCDRAFT_43278Help
Entry
MICPUCDRAFT_43278 CDS       T02696                                 

Definition
(RefSeq) isochorismate synthase
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
mpp  Micromonas pusilla
Pathway
mpp00130  Ubiquinone and other terpenoid-quinone biosynthesis
mpp01100  Metabolic pathways
mpp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MICPUCDRAFT_43278
Enzymes [BR:mpp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     MICPUCDRAFT_43278
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     MICPUCDRAFT_43278
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     MICPUCDRAFT_43278
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     MICPUCDRAFT_43278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind TPP_enzyme_N Abhydrolase_6 Abhydrolase_1 TPP_enzyme_M_2 Esterase Hydrolase_4 DLH
Motif
Other DBs
NCBI-GeneID: 9689674
NCBI-ProteinID: XP_003064233
JGI: 43278
UniProt: C1N8A0
AA seq 2507 aa AA seqDB search
MASFAAAAPLTTRPARAGAAPSPATASSSSRRGGGVVVVRPTRGARRAASASASASGARS
SGSNPAPARGKKPRRRRVADPSAGGGKLETTRAAVATDAADIVPALDDDDDDDDASSRAA
SSSASSSSSSRTRSPVETSQHIHLGAAASASDALRRLRDGLRGLVLDAGGGAVPPFRSGL
FRLTVAIPRGADALEWLSRLPRDAPALLPMYYMSPRTPPPSVRAERAGAGGARGRSAADD
DDDDDDDSFAASENAAAHAEPPGWRADPRGAVAAAGGACVWTSPDAFGATQLASVRRWTH
TCEPSDGGPRAYGCGRFDAARPGGADEEWAAFGGHYFALPLLEVVEGTRCCTVAVHVAWE
RSSGYDAGEDGTSIGGGGGGGGATAGDFAAAVAAAVDAVDAASEAHAPVRIRSGLNANDD
DDDDKRTTETTSGGVARLPPGAARVLSRELRPDRSGWTDVVDGLLKSLREGEAAAAAAAV
QAARAAAEREAAEREAAAPPSATASATATAGSGPARTYVWDEEYAYKEEQDSYVDAFASG
DGIYGPGSSVGAGPGDQRRRDERSVIRDKLLELGRSAGVEAPPASVMRDLEAFAMAAGMG
ANATNSALAPGSDFNSGDWSDADDIGSIGLGWGATDVDPESGGGASAASAERVADAMAVA
EGEATEADDVDDDALAPLRKVVLARRTTLALSDAIDALSLVSSLRARDPDAYQFALIHPS
GAAFVGSTPERLFSSRDGHAASEAVAGTRPRGADEGEDAALAYQMLLSPKEHEEFAIVRE
EVRRALGSVADGGARGVNAELEKGVLRHVSVQHLYARLGAKLAPGKDEADVLRALHPTPA
VCGHPRRAALRAIRASESFDRGLYAGPVGWVSRDAAEFAVAIRSALVSPSGVDVKLFAGV
GVVAAADSAAEWRELNLKTRPLEALLAQKPSLDAAVNANAAWADVLIGELVHGGVHVFCV
APGSRSTPLALAAEKHQTARVVVCVDERSLGFYALGYGKGRGRAAAVITSSGTAVANLLP
ACVEAHESGAPLLLLTADRPPELRDTGANQTIDQVKIFEGFARYAVDLPPPGDGAPARVY
ATAAATAARHLHGDRPGPVHLNVQFRDPLGPVKSAWDPARDLRGLEGWERRAAPFVSGGA
SGASGGGADGDGAVGELCALVRSARRGLLVVAGGGTASDALAACEIAALLGWAVVADAAS
GLRVRGAEIGGSSSAPRASSWSVAGGVCPGLLDGLDLALCSPEFREWFDPDVIVQINPRI
TSKRVQTALERAAIDRRAAWAVATNRDARVDPGHCVSLHVASDASAVATALETLLGGGRH
GDGAGGGGGGGGTYVVGNGSNIGVSSSGCYVGSDGHASCVAFREKLAAIDAAATREADAA
LRDIESEEGISEMAVALAVTEALPASSGLFIGNSMPIRDVDALSGLRSSARGGGGGRGGG
GGAGGPGAPVAANRGASGIDGIISTAAGYAAGLSQPVTLLIGDVSFQHDSNGLLLLRERP
GQPPVTIVVVNNGGGGIFSFLPVADQIDPGAFTKLFATPPDVSRKGLCDAHRIAHAHPST
PEGLKKALRAAWSEGRHNVVEVSTSRASNLKQHRAVQARVAAAASAALRLLEGGGGAAAA
AAAKAKATPRVISAEVTDFTLPLRRPPTTTATATATADDAVRRGWLLKVVLDDGSIGWGE
ASPLPGLHLESHDAAGAQLRTVASIVDGSAAGGGGSGGGGVFVDATLPLLNGAVAEWLTS
ACGVREDALLPSVRFALETAVLSALACRSSSSGGGGGGGECNAPLASVLLLGDAGNASSP
SAAADSENFVEINALIPDDALATPEDVANAARHLVAKGFRCLKLKVARGEGTAGAFDDAK
KVKAMRDAVGDDIIDCRVQYVEEPVSDLVDLAAFHCTTGVPVALDESVDEAMRGGADGAR
DGDGDDDDDSTGSLNALIELFEPSNGVVAIVLKPSVIGGFERCARAAAAARSRGVASVVT
TAFDAGVGADACANLARALDAAAAKAAADASAAAAAADDDDDDDASGGGGDDDDGWDAAA
ARVGVGVAAADREPSLVARLAPMRHGLGTGEWLDGDVFDPPAAPLDFSSASAGGGVRVAL
APAAASARRKTTAAVSEMNTTTTTTTTTAWGAESVYEAKTSRGTYSIRVVDSGGGGGDAR
PPVLLLHGFLGGAEDWHAIASGLSRSHRVVAIDLPGHGGSALTPLEEEDDEEKDDDDDDD
DDDGGKVLKERRSPRERDRMGTSVDGRSKYDVESVSDAVAALIPALGASKAIVVGYSLGA
RIALHLAATRPDVVHAVASIGGSGGIVDSIDRATRAARDDAAAAALRDGGVAPFATAWYA
QPLFRALSTHPRWRGGKIAAARARNSGDARELADVLRGMSPGRQPAVTGRDVRDVARAGG
ALFVAGGEDVKFTAIARALARECGDGDDRDTSSRVEVVVVPGAGHAVHLEAPEALIRALT
TFVATATARAAISAAGATDDAKGGKKTRARRYGGARAGNATPRDDAK
NT seq 7524 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccttcgcggccgcggcgccgttgacgacgcgtcccgcgcgcgcgggcgcggcg
ccgtcgccggcgaccgcgtcgagctcgtctcgccgcggtggcggggtcgtcgtcgtccgt
ccgacgcgcggcgcgcggcgcgcggcgtccgcgtccgcgtccgcgagcggcgcgcgatcg
agcggatcgaaccccgcgcccgcgagagggaagaagccgcgacgtcgccgcgtcgcggat
ccgagcgcggggggggggaagctcgagacgacgcgcgcggcggtcgcgacggacgccgcg
gacatcgttccggcgctggacgacgacgacgacgacgacgacgcgtcgtcgcgcgcggcg
tcgtcctccgcctcctcctcctcctcctcgcggacccgctctccggtggagacgtcccag
cacatccacctcggcgccgccgcgagcgcgagcgacgcgctgcgacgcctccgcgacggc
ctgcgagggctcgtcctcgacgccggcggcggcgccgtcccgccgttccgctccggatta
ttccgactcaccgtcgcgatccctcgcggcgcggacgccctcgagtggctctcccggctc
cccagagacgcgcccgcgctgctgccgatgtattacatgtccccgaggacgccgccgccg
agcgtccgcgcggagcgcgccggcgccggcggcgcccgcggacgctcagcggcggacgac
gacgacgacgacgacgacgactccttcgctgcgtcggaaaacgcggcggcgcacgcggaa
cctcccggctggcgcgcagaccctcgaggcgcggtcgccgccgccggcggcgcgtgcgtc
tggacctcccccgacgccttcggcgcgacgcagctcgcgagcgtgcggcggtggacgcac
acgtgcgagccgagcgacggcggcccgcgcgcgtacggatgcggtcggttcgacgcggcg
cgacctggcggcgcggacgaggagtgggcggcgtttggggggcactacttcgcgctgccg
ctgctggaggtggtggaggggacgcggtgctgcaccgtcgcggtgcacgtcgcgtgggag
cggagtagtggttatgatgcgggggaagatggaacgtcgatcggcggcggcggcggcggc
ggcggcgcgacggcgggggatttcgcggcggcggtggccgccgccgtcgacgccgtggac
gccgcgtcggaggcgcacgcgccggttcggatccgaagcggcttgaacgcgaacgacgac
gacgacgacgacaaaagaacgaccgaaacgacgagcggcggcgtcgcgcggctccctccc
ggcgccgcgcgggtgctctcgcgcgagctgcgaccggaccggtccggatggacggacgtc
gtggacggtttgctcaagtcgctgcgcgagggagaggcggcggcggcggcggcggcggtt
caggcggcgagagccgcggccgagcgcgaggcggccgagcgcgaggcggccgcgccgccg
agcgcgaccgcgagcgcgaccgcgaccgccggatccggcccggcgaggacctacgtgtgg
gacgaggaatacgcgtacaaggaggagcaagacagttacgtggacgcgttcgcgtccggc
gacgggatctacggacccggctcatcggtgggcgcgggccccggcgatcaacggcgacga
gacgaacggagcgtgatacgcgataagctcctggagctcgggcggtccgcgggcgtggag
gcgccgcccgcgagcgtgatgagagatctcgaggcgttcgcgatggcggcggggatgggc
gcgaacgctacgaacagcgcgctcgcaccagggtcggatttcaacagcggggactggtcc
gacgcggacgacatcgggagcatcggtctcggatggggcgcgacggacgtggaccctgag
agcggcggcggcgcttccgcggcgagcgcggagcgcgtagcggacgcgatggcggtggcg
gagggcgaagcgactgaagccgacgacgtcgacgacgacgcgctcgcgccgctccgcaag
gttgtcctcgcgcgccggacgacgctcgcgctctcggacgcgatcgacgcgctgtcgctg
gtgtcctccctccgcgcgcgcgaccctgacgcgtaccagttcgcgctgatccacccgtcg
ggcgcggctttcgtcggatccacgcccgagcgtttattttcgtcgagggacggccacgcc
gcgtcggaggccgtcgcggggacgcgcccgcgcggcgcggacgagggcgaggacgccgcg
ctcgcgtaccagatgctcctctcgccgaaagagcacgaggagttcgcgatcgttcgggag
gaagtgcggcgcgcgctcggttccgtcgcggacgggggcgcgcgcggggtcaacgcagag
ttggaaaaaggcgtcttgcggcacgtctccgtccagcacctctacgcgcggctcggcgcc
aagctcgcgcccgggaaggacgaggcggacgttctcagagcgctgcatccgacgcccgcg
gtgtgcgggcatccgaggcgcgcggcgctgcgcgcgattcgcgcgtccgagagcttcgat
cgagggttgtacgcgggaccggtggggtgggtgtctcgcgacgccgcggagtttgccgtg
gcgattcgatccgcgctcgtgtctccgtccggcgtggacgtgaaactcttcgccggcgtc
ggcgtcgtcgccgccgcggacagcgccgcggagtggcgcgagctgaacctaaaaacgcgc
cccctcgaggcgttactcgcgcaaaaacccagcctcgacgccgccgtcaacgccaacgcg
gcgtgggcggacgtcctgatcggcgagctcgtccacggcggggtccacgtcttctgcgtc
gcgcccgggtctcgatccaccccgctcgcgctcgcggcggagaagcaccagaccgcgcgc
gtcgtcgtgtgcgtggacgagcggagtttaggattttacgccctagggtacggcaaagga
agaggcagagccgccgcggtgatcacgagcagcggcaccgcggtcgccaacctgctcccc
gcgtgcgtcgaggcgcacgagagcggcgcgccgctgctgctgctcaccgcggaccgcccc
ccggagctgcgcgacacgggcgcgaaccagacgatcgaccaggtgaagatcttcgagggg
ttcgcgcgctacgccgtggatttgcccccgcccggcgacggcgcgcccgcgcgcgtctac
gcgacggcggcggcgacggcggcgcgacacctccacggcgatcgaccgggtcccgtgcat
ttgaacgtgcagttccgcgacccgctcgggccggtgaagagcgcgtgggatccggcgcgg
gacctgcgggggctcgaggggtgggagcggcgcgcggcgccgttcgtgagcggcggcgcg
agcggcgcgagcggaggcggcgcggacggcgacggcgctgtcggggaactgtgcgcgctc
gtgcgatccgcgcggcgcgggctgctcgtcgtcgccggcggcgggacggcttcggacgcg
ctcgccgcgtgcgagatcgccgcccttctcggctgggcggtcgtcgcggacgcggcgtcg
gggcttcgcgtgcgcggcgccgaaatcgggggatcgtcgagcgcgccgcgggcttcttcg
tggtccgtggcgggcggcgtctgccccggccttctcgacggcctcgacctcgcgctgtgc
tctccggagttccgcgagtggttcgacccggacgtcatcgtgcagatcaacccgaggatc
acgtcgaagcgcgtgcagaccgcgctcgagcgcgccgcgatcgatcgacgcgcggcgtgg
gcggtggcgacgaaccgagacgcgcgcgtcgaccccggccactgcgtctcgttgcacgtc
gcgtcggacgcgtccgcggtggctaccgcgctggagacgctgctcggcggcggtcgtcac
ggcgacggcgctggcgggggtggcgggggtggcgggacgtatgtggttggaaacggctcg
aatattggcgtttcttcgagtgggtgttacgtcggcagcgacgggcacgcgtcgtgcgtc
gcgtttcgcgagaagctcgcggcgatcgacgccgcggcgacgcgcgaagccgacgccgcg
ctccgcgacatcgagtccgaggagggcatctccgagatggcggtcgcgctcgcggtgacc
gaggcgcttcccgcgtcgagcggtcttttcatcgggaactcgatgccgatccgcgacgtc
gacgcgctctcggggctgcgatcctcggcgagaggaggaggaggaggacgcggcggcggc
ggcggcgcggggggaccgggcgcgcccgtcgcggcgaatcgcggcgcgagcggcatcgac
ggcatcatctccaccgcggcggggtacgccgcgggcctctcccagcccgtcacgctgctc
atcggcgacgtttcgttccagcatgacagcaacgggttactgttactccgcgagcggccc
gggcagccgccggtgacgatcgtcgtcgtcaacaacggcggcggcggcatcttcagcttc
ctccccgtcgccgaccagatcgatcccggcgcgttcacgaagctcttcgcgacgccgccg
gacgtgagccgaaaaggcctgtgcgacgcgcacaggatcgcgcacgcgcatccgagcacg
ccggaggggttgaagaaggcgctgcgcgcggcgtggagcgagggaaggcacaacgtcgtc
gaggtgtcgacctcccgcgcgtccaacttgaagcagcatcgcgcggtgcaggctcgcgtc
gccgcggcggcgagcgcggcgctgcggctgctggagggcggcggcggcgcggcggcggcg
gcggcggcgaaggcgaaggcgacgccgcgggtgataagcgcggaggtgacggatttcacg
ctgccgctgcgtcgaccgccgacgacgacggcgacggcgacggcgacggcggacgacgcc
gtccgacgcggatggttgctgaaagtcgtcctcgacgacggctcgatcgggtggggcgag
gcgagcccgctcccgggccttcacctcgagtcgcacgacgccgcgggcgcgcagttgcgg
acggtcgcgtccatcgtcgacggctccgccgcgggcggcggcggttcaggcggcggcggg
gttttcgtggacgcgacgctgccgctgcttaacggtgccgtcgccgagtggctgacgtcc
gcgtgcggcgtgcgcgaggacgcgctgctgccgtccgtgcgtttcgcgctcgagaccgcg
gtgttatccgcgctcgcgtgtagatcgtcgtcctcggggggaggaggaggaggaggagaa
tgtaacgcgccgctcgcgagcgttttactgctcggcgacgcggggaacgcctcgtcgccg
tcggcggcggcggactcggagaacttcgtggagatcaacgcgttgattcccgacgacgcg
ctcgcgacgcccgaggacgtcgcgaacgccgcgagacatctcgtcgcgaaggggttccga
tgcctcaagctcaaggtggcgcgcggcgagggcaccgcgggcgcgttcgacgacgcgaag
aaggtcaaggcgatgagagacgccgtcggcgacgacatcatcgactgccgcgtgcagtac
gtcgaggagcccgtgagcgacctcgtggacttggccgcgttccactgcacgacgggcgtg
ccggtcgcgctcgacgagagcgtggacgaggcgatgcgcggcggcgcggacggcgctcgc
gacggcgacggcgacgacgacgacgactcgacggggtcgctgaacgcgttgatcgagctg
ttcgaaccgagcaacggcgtcgtcgcgatcgtcttgaaaccgtccgtgatcggagggttc
gaacggtgcgcgcgcgcggcagccgcggcgaggagccgcggcgtcgcgagcgtcgtcacg
accgcgttcgacgccggcgtcggcgcggacgcgtgcgcgaacctcgcccgcgcgctcgac
gccgccgcagcgaaagccgcggcggacgcgtccgccgccgccgccgccgccgacgacgac
gacgacgacgacgcgtccggcggcggcggcgacgacgacgacgggtgggacgccgccgcc
gcgcgcgtcggcgtcggcgtcgccgccgcggaccgagagccgagcctcgtcgccaggctc
gcgccgatgcggcacgggttggggactggggagtggctcgacggcgacgtgttcgatccc
cccgcggcgccgttggacttttcgtcggcttcggcgggcggcggcgtccgcgtcgcgctc
gcgccggcggcggcgtccgcgaggaggaagacgaccgcggcggtgtcggagatgaacacg
acgacgacgacgacgacgacgaccgcgtggggcgcggagagcgtctacgaggcgaagacg
agccgcggaacgtacagcatccgcgtcgtggacagcggcggcggcggcggcgacgcgcgt
ccgccggtgcttctccttcacgggtttctcggcggcgcggaggactggcacgcgatcgcg
tcggggctctcgagatcgcaccgcgtcgtcgcgatcgacctcccggggcacggcggcagc
gcgctgaccccgctcgaagaggaggacgacgaagagaaggacgacgacgacgacgacgac
gacgacgacggcggaaaagttcttaaggaacggcgttcaccacgcgaacgggatcgtatg
gggaccagtgtagacggccgatccaagtacgacgtcgaatccgtctccgacgccgtcgcg
gcgttgattcccgcgctcggcgcgtccaaagcgatcgtcgtggggtactccctcggcgcg
cgcatcgcgcttcacctcgcggcgacgcgccccgacgtcgtccacgccgtcgcgtccatc
ggaggcagcggcgggatcgtcgactcgatcgaccgagcgacgcgcgcggcgcgcgacgac
gccgccgccgccgcgttgcgcgacggcggcgtcgctccgttcgcgaccgcgtggtacgcg
cagccgctgttccgcgcgctgtcgacgcacccgcggtggcgcggcgggaagatcgcggcg
gccagagcgcggaacagcggcgacgcgcgcgagctcgcggacgtcctgcgcggcatgtcc
ccggggcgacagccggcggtgacggggcgagacgtccgcgacgtcgcgcgcgcggggggg
gcgcttttcgtagcgggcggcgaggacgtgaagtttacggcgatcgcgcgcgcgctcgcg
agggagtgcggcgacggcgacgatagagacacttcttctcgcgtcgaggtggtcgttgtc
cccggcgccgggcacgcggtgcatctggaagcccccgaggcgttgattcgcgcgttgacg
acgttcgtcgcgacggcgacggcgagggcggcgatttcggcggcaggcgcgacggacgac
gcgaagggcgggaagaagacgcgcgcgcggcggtacggcggcgcgcgcgcggggaacgcg
acgccgcgagacgacgcgaagtga

DBGET integrated database retrieval system