KEGG   Micromonas pusilla: MICPUCDRAFT_43803Help
Entry
MICPUCDRAFT_43803 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mpp  Micromonas pusilla
Pathway
mpp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MICPUCDRAFT_43803
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MICPUCDRAFT_43803
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MICPUCDRAFT_43803
DNA repair and recombination proteins [BR:mpp03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MICPUCDRAFT_43803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH PsbP
Motif
Other DBs
NCBI-GeneID: 9680309
NCBI-ProteinID: XP_003055501
JGI: 43803
UniProt: C1MHI9
AA seq 330 aa AA seqDB search
MPELPEVESARVLCEKHIVGATIVSVEFNEDGTYDEKIFKEIDESQFTSALKGRTVKAAR
RLGKHLWWDLGTRSTPLFHFGMTGAMTIKGGGSIVKYKAFAVDTVNWPPRFAKLVVTFSN
GVTLAYTDPRRFGRVRLVDGVVTESPPLSDLGFDPLLAMPDEKTFASLFAKRAAPVKAVL
LDQKVAAGVGNWVADEVLFHARVHPEQPAKSLTHGQLAMVRDAMSMVVTVACEAGAISEK
FPEDWLFHHRWGKVTGNKVGGRTTAFVPSVQKKTSVNAKAPPVAKEKKMKQTAKRPAAAA
AAAKTAAAKPAAKRPRRTRTAAIVKLACVF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttcccgaagtggagagtgcacgcgtcctatgcgagaagcacatcgtcggc
gcgacgatcgtaagcgtcgagtttaacgaagacggcacgtacgacgagaagatcttcaaa
gagatcgacgaatcacagttcacgtcggcgctcaaaggaagaaccgtcaaagcggcaagg
cgattgggaaagcatctgtggtgggatctcgggacgcgaagtacgcctttatttcatttc
gggatgaccggcgcgatgacgatcaaaggcgggggaagcattgtgaagtacaaggcgttc
gctgtagacacggtgaactggccaccgcggttcgccaagctggtagtcacgttcagtaac
ggcgtgacgctcgcgtacaccgacccgcgccgattcggccgcgtgcgcctcgtggacggc
gtcgtcacggagtccccgccgctgtccgacctcggcttcgatccgttgctcgcgatgccg
gacgagaagacgttcgcgtcgctcttcgcgaaacgcgcggcgccggtcaaggcggtgcta
ttggatcaaaaggtcgccgctggcgtcgggaactgggtcgcggacgaggtgctcttccac
gccagggtgcatcctgaacagcctgcgaagtcgttgacgcacggccagctggcgatggtg
cgcgacgcgatgtcgatggtcgtgaccgtcgcgtgcgaggccggagctatatctgagaaa
tttccagaggactggctgttccatcaccggtggggtaaagtgacggggaacaaggttggc
ggacgcacgaccgcgttcgtgccctccgtgcagaagaagacgagcgtgaacgccaaggcg
ccgccggtcgcgaaagagaaaaagatgaaacaaacggcgaagcgaccggcggcggcggcg
gcggcggcgaagaccgccgccgcgaaacccgcggcgaagcgcccgcgtcggacgcgaacg
gcggccatcgtgaaactagcgtgcgtgttctga

DBGET integrated database retrieval system