KEGG   Micromonas pusilla: MICPUCDRAFT_45784Help
Entry
MICPUCDRAFT_45784 CDS       T02696                                 

Definition
(RefSeq) histone acetyltransferase
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUCDRAFT_45784
Transfer RNA biogenesis [BR:mpp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MICPUCDRAFT_45784
Chromosome and associated proteins [BR:mpp03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    MICPUCDRAFT_45784
   HAT complexes
    Elongator complex
     MICPUCDRAFT_45784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 9686764
NCBI-ProteinID: XP_003061055
JGI: 45784
UniProt: C1N030
AA seq 525 aa AA seqDB search
MIASVKSGKVMNLNAVKNAAARKYGLRRSPKLVELISAVPDEHRDALLPALRAKPVRTAS
GIAVVAVMSKPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPY
VQARGRVDQLRKLGHSVDKVEYILMGGTFMSLPAEYRDWFVRNLHDALSGASSASVADAV
AASEQSRMKCVGLTIETRPDYCLSPHLRQMLLYGCTRLEIGLQSIYEDVARDTNRGHTVE
AVQKCFELAKDAGFKVVVHMMPDLPNVGMERDLESFREFFESPDFRTDGLKLYPTLVIRG
TGLYELWRTGRYRNYAPDRLVDLVARALALVPPWVRVYRVQRDIPMPLVTAGVEKGNLRE
LALARMGDLGLRCRDVRTREVGIQDIHSKVKPEEVELVRRDYAANGGWETFLSYEDPRQD
ILVGLLRLRRCGATAAATSPELRGQKCSMVRELHVYGSAVAVHSRERGKFQHQGYGTLLM
REAERIARREHRSAKLAVISGVGTRHYYRKLGYELEGPYMVKTLR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtccgtgaagtccggcaaggtgatgaacctcaacgccgtcaagaacgcggcc
gcgcggaaatacggcctgcgccgatcgcccaagctcgtcgagctcatcagcgcggtcccg
gacgagcaccgcgacgcgctcctcccggcgctgcgcgcgaagccggtgcggaccgcgagc
gggatcgcggtcgtcgcggtgatgtccaagccgcatcggtgcccgcacatcgcgaccacg
gggaacatatgcgtctactgcccgggagggccggattccgatttcgagtactccacgcag
tcgtacacagggtacgagccgacgtccatgcgcgcgattcgcgcgcggtacgacccgtac
gtccaagcgcgcgggcgcgtggatcagctgcggaagctcgggcacagcgtggacaaggtg
gagtacatcctcatgggcgggacgttcatgagcttgcccgcggagtaccgggactggttc
gtgaggaacctgcacgacgcgctgtccggcgcgagcagcgcgtccgtcgcggacgcggtc
gccgcgtccgagcagtcgagaatgaagtgcgtcgggctgacgatcgagacgcggccggac
tactgcctgtcgccgcatctgcgtcagatgcttctgtacgggtgcacgcgcctggagatc
gggctgcagtcgatttacgaggacgtcgcgcgggatacgaaccgagggcacacggtcgag
gcggtgcagaagtgtttcgagctcgcgaaggacgccgggttcaaagtcgtcgtgcacatg
atgccggatctgcccaacgttgggatggaacgcgacctggagtcgtttcgcgagtttttc
gagagcccagactttcgcacagacggcttgaagctctacccgacgctcgtcatccgcggc
accggtctgtacgaactctggcgcacggggcgataccgcaactacgcgcccgatcgcctc
gtggacctcgtcgcgcgcgcgctcgcgctcgtcccgccgtgggtccgcgtgtacagagtc
caacgcgatatcccgatgccactcgtcaccgcgggcgtcgagaagggcaacctccgagag
ctcgcgctcgcgcgcatgggcgacctcgggctccggtgccgcgacgtgcggacgcgcgag
gttgggatccaggacatccacagcaaggtgaagcccgaggaggttgagttggtgcgtcga
gactacgcggcgaacggcgggtgggagacgtttttgtcgtacgaagacccgcggcaggac
atcctcgtcgggctgcttcggcttcggcggtgcggcgcgaccgcggccgcgacgtcgccg
gagctgagaggtcagaagtgttccatggtgcgagagttgcacgtgtacggcagcgcggtg
gcggtgcactcgcgcgagcgagggaagtttcagcaccaggggtacggcacgttgctcatg
cgcgaggcggagcgcatcgcgcggcgggagcaccggagcgcgaagctcgcggtcatctcc
ggcgtggggacgcggcattactaccggaagctcgggtacgagctcgagggaccgtacatg
gtgaagacgttgcgatga

DBGET integrated database retrieval system