KEGG   Micromonas pusilla: MICPUCDRAFT_57107Help
Entry
MICPUCDRAFT_57107 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mpp  Micromonas pusilla
Pathway
mpp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MICPUCDRAFT_57107
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mpp03041]
    MICPUCDRAFT_57107
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MICPUCDRAFT_57107
Spliceosome [BR:mpp03041]
 Complex C
  Other components
   Step II factors
    MICPUCDRAFT_57107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S1 AAA_22 DEAD AAA_19 AAA_30 T2SSE PRP38_assoc DUF2075 AAA_14 Flavi_DEAD ABC_tran PhoH Sigma54_activ_2 ATPase
Motif
Other DBs
NCBI-GeneID: 9683478
NCBI-ProteinID: XP_003058040
JGI: 57107
UniProt: C1MQ03
AA seq 698 aa AA seqDB search
MALNKLAHLSLVNKVTTELENHIGIADKTLSEFVIDLASKHADDARGFQAALEDVGAELS
FDLVTNLLNIIQRMKGGGAKKPAVADGGGGSGGHARPLRPTKENPLPGLSVLDDEERAKA
LTREIYGDNPITANMADDPRFLSRAREDDRDRGRDRGRGGGRDDDDDRGGGRRRDRSRDG
GGGPSSAAALKQGEPEVGAIYRGRVTNVMDFGCFVELTEFERRFEGLVHVSLMSSLKQIN
AREQVSKDQRVWVKVTTRSSTRMALSMRDVNQDTGDDLMGVHGDAYAVNPSASNRPPPAP
GASLRGLSGINLTDEDRLADTRRRPVKRLSSPERWEAKQLIASGVLPVEEYPTYDAENDG
LLAYEEEAEQEVEIEINEEEAPFLAGQTAAEGDVSPIKIVKNPDGSLQRAAMTQSALAKE
RRELKEQQQRTMLDSVPKDLNRPWEDPMPEAGERHLAQELRGVGLAGYEMPEWKVEAFGK
APTFGQKSALPMQAQRESLPIFKLRDELIQAVNDNQVLVVIGETGSGKTTQMTQYLAESG
YTSRGRIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTSPETVIKYMTDGML
LRETLLDDMLSQYCLIMLDEAHERTIHTDVLFGLLKKCCAKRKDLKIIVTSATLDAEKFS
SYFFNCPIFTIPGRTFPVEVLYTKAPESVRVVSPLVVT
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaacaagctcgcgcacttgagcttagtgaacaaggtcacgaccgagctcgag
aaccacatcgggatcgcggacaagacgctgtcggagttcgtgatcgacctcgcgtcgaag
cacgcggacgacgcgcgcgggttccaagccgcgctcgaggacgtcggcgcggagctgagc
ttcgatctcgtgacgaacttgctgaacatcatccagaggatgaaaggcggcggggcgaag
aagcccgccgtcgcggacggcggcggcggaagcggcggccacgcgcgaccgctgcgaccg
acgaaggagaatcccctccccgggctcagcgtcttggacgacgaagagcgcgcgaaggcg
ctcacgagagagatctacggcgacaacccgatcacggcgaacatggcggacgacccgcgg
ttcttgtcgcgcgcgcgggaagacgaccgggaccgaggaagggaccgaggacgcggcggc
gggcgagacgacgacgacgaccgcgggggagggcgtcgacgcgatcgctcccgcgacggc
ggcggcggaccttcctccgcggcggcgctgaagcaaggcgagcccgaggtcggggcgata
taccgcggcagggtcacgaacgtcatggactttgggtgcttcgtcgagctcacggagttc
gaacgaaggttcgaagggttagtgcacgtctcgttgatgtcgtccctgaagcaaatcaac
gcgcgcgagcaggtgagcaaagaccagagagtgtgggtcaaagtcacgacgcggtcgtcc
acgcgcatggcgctgtccatgcgcgacgtgaaccaggacaccggcgacgacctcatgggc
gtccacggggacgcgtacgcggtgaatccgagcgcgtcgaaccgaccgccgccggcgccc
ggcgcgagcttacgcggcctctctgggatcaacctgaccgacgaggatcgactcgcggac
acgcggcgacgaccggtgaagcgcttatcctccccggagcggtgggaagcgaagcagctg
atcgcgtccggggtcctccccgtggaggagtacccgacgtacgacgcggagaacgatggg
ctgctcgcgtacgaggaggaggcggagcaggaggtggagatcgagatcaacgaggaggag
gcgccgttcctcgcgggtcagaccgccgcggagggggacgtcagcccgattaagatcgtg
aagaacccggacgggagcttacagcgcgcggcgatgacgcagagcgcgctcgcgaaggaa
cgcagagagctcaaggagcagcagcagcggacgatgctggattccgtcccgaaagatttg
aaccggccgtgggaggatccgatgccggaggcgggagagaggcacctcgcgcaggagctt
cgcggcgtcgggctcgcggggtatgagatgccggagtggaaagtcgaagcgttcgggaag
gcgccgacgtttgggcagaaatccgcgctcccgatgcaagcgcaacgcgagtcgcttccg
atttttaagctccgcgacgagctcatccaggcggtgaacgataaccaagtcttagtcgtc
atcggcgagaccgggtctggtaaaacgacgcagatgacgcagtacctcgcggagagcggg
tacacctcgagagggaggatcgggtgcacgcagccgcggcgagtagcggcgatgtctgtc
gcgaaacgcgtcgcggaagagtttggctgccgcctcggcgaggaggtcggatacgcgatt
cgattcgaggattgcacgtcaccggagacggtgatcaagtacatgactgacggtatgctt
ctgagagagacgctcctggacgacatgctctcgcagtactgcctcatcatgctcgacgaa
gcgcacgagcggacgattcacacggacgttttgtttgggctgttgaagaagtgctgcgcg
aaacggaaagacctgaagatcatcgtcacgtccgcgacgctcgacgcggagaagttctcg
tcgtacttcttcaactgccccatcttcacgatccccgggcggacgttcccggtcgaggtc
ctgtacacgaaagcgccggagtcggtacgtgtggtttcccccctcgtcgtgacctga

DBGET integrated database retrieval system