KEGG   Micromonas pusilla: MICPUCDRAFT_70268Help
Entry
MICPUCDRAFT_70268 CDS       T02696                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mpp  Micromonas pusilla
Pathway
mpp00450  Selenocompound metabolism
mpp00970  Aminoacyl-tRNA biosynthesis
mpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MICPUCDRAFT_70268
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MICPUCDRAFT_70268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpp01007]
    MICPUCDRAFT_70268
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpp03016]
    MICPUCDRAFT_70268
Enzymes [BR:mpp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MICPUCDRAFT_70268
Amino acid related enzymes [BR:mpp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MICPUCDRAFT_70268
Transfer RNA biogenesis [BR:mpp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MICPUCDRAFT_70268
 Prokaryotic type
   Other AARSs
    MICPUCDRAFT_70268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 9683427
NCBI-ProteinID: XP_003057617
JGI: 70268
UniProt: C1MPP4
AA seq 632 aa AA seqDB search
MPPMKLKFCITTAINYANGAPHMGHAYEAISTDCIARYHRAYGRDVLYQTGSDEHGQKIA
EAAETAGCEPIELCDKYVAAFQDLNAKTSVANDVYNRTTSPEHHEACGELFRRSRDNGDI
YLDTYEGWYNVREEMFVTETDAAAADYKDPVSGKPLKKMSEESYFFRMSKYQSRLIEYIE
ENPEFIQPTRRRNEILARLREDELRDLSVSRTTFDWGIPVPDTPGHVLYVWFDALTNYLT
GVGWPKKEVTDGGNPFWPPAVQIIGKDITWFHCVIWPCMLFSAKIPLPKTVFGHGFVTAS
DGQKMSKSIGNVVDPLEQLAKYPSDSFRYYLMRNGVYGSDIPFSEANLVYVHNADLADVL
GNLVHRATNLCAKNCAGVVPDVAPERVFDVGALRATSEHAMKNLETQKCCELAINAMKDT
NKYLTDAAPWAVKGDGAAERKAVIIRSTLEAVYAAAHFLSPFIPAACDHIFEKLGAPAKP
IWRLSRESNLTPGTTVSVGGILFAKFEVEGENAEGGASGGGGDGKKKGKAAAAPPPPKKK
EPPKDAPVDVSRLCIRVGTITKVWRHPDAEKLYCELIDIGESAPRQVVSGLVDHVPEDEM
LGARVVVVANMKARSYSHWYPYDRVGVVNFIP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgccccccatgaagctcaagttttgcatcactacggcgatcaactacgcgaacggcgcg
ccgcacatgggccacgcgtacgaggcgatctccacggactgcatcgcgcggtatcaccgc
gcgtacggaagagacgtgctctatcagacgggctcggacgagcacgggcaaaagatcgcg
gaagccgcggagaccgcggggtgcgagcccatcgaactgtgcgataagtacgtcgccgcg
ttccaggacttgaacgcgaagacgtccgtggcgaacgacgtgtacaaccggacgacgagc
ccggagcatcacgaggcgtgcggggagttgttccgacggtcgagagacaacggggacatc
tacctcgacacgtacgaagggtggtacaacgtgagggaggagatgttcgtgaccgagacg
gacgccgcggcggcggattacaaagacccggtgagcgggaagccgctgaagaagatgagc
gaggagagctactttttccggatgagcaagtaccagtcccggttgatcgagtacatcgaa
gagaacccggagtttattcagccgacgcgccgtcgcaacgaaattctcgcgcggttacga
gaggacgaactgagagatttatccgtctcgaggacgacgttcgactggggcatccccgtt
ccggacacgcccgggcacgtgctgtacgtctggttcgacgcgctgacgaattacctcacc
ggcgtgggctggccgaagaaggaggtgaccgacggcggcaatccgttttggccccccgcg
gtgcaaatcatcggaaaagacatcacgtggttccactgcgtgatttggccgtgcatgctg
ttctccgcgaagatcccgctgccgaagacggtgttcgggcacgggttcgtgaccgcatcg
gacgggcagaagatgagcaagtccatcggcaacgtcgtcgacccgctcgagcagctcgcg
aagtatcccagcgactcgtttcgctattacctcatgcggaacggcgtctacggaagcgac
attcccttctccgaggcgaacttggtgtacgtccacaacgcggacctcgcggacgtgctt
ggaaacttagtccacagggcgacgaacctctgcgcgaagaactgcgccggcgtcgtcccg
gacgtcgccccggagcgcgtcttcgacgtcggcgcgttgcgcgcgacgtccgagcacgcg
atgaaaaacctcgagacgcaaaaatgctgcgagctcgccatcaacgcgatgaaggacacg
aacaagtacctcacggacgccgcgccgtgggcggtcaagggcgacggcgcggcggagcgt
aaggcggtgatcattcggtccacgctcgaggcggtgtacgccgccgcgcacttcctgtcg
ccgttcatccccgcggcgtgcgaccacattttcgaaaagctcggcgcccccgcgaagccg
atctggaggctgagccgcgaatcgaacctgacgcccgggacgacggtcagcgtgggcggg
attctcttcgcgaagttcgaggtcgagggcgaaaacgcggagggcggcgcgagcggcggc
ggcggcgacgggaagaagaagggcaaagccgccgccgcgccgccgccgccgaaaaagaag
gagccccccaaggacgcccccgtcgacgtctcgcgcctgtgcatccgcgtcgggacgatc
accaaggtctggcggcacccggacgcggagaagctgtactgcgagctcatcgatatcggc
gagtccgcgccgcggcaggtggtctccggcctcgtggaccacgtcccggaggacgagatg
ctgggcgcgcgcgtcgtcgtcgtggccaacatgaaggcgcgttcgtattcgcactggtac
ccatacgaccgcgttggcgttgtgaacttcattccttaa

DBGET integrated database retrieval system