KEGG   Marinobacter psychrophilus: ABA45_06860Help
Entry
ABA45_06860       CDS       T03980                                 

Definition
(GenBank) sirohydrochlorin ferrochelatase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00860  Porphyrin and chlorophyll metabolism
mpq01100  Metabolic pathways
mpq01110  Biosynthesis of secondary metabolites
mpq01120  Microbial metabolism in diverse environments
Module
mpq_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABA45_06860
Enzymes [BR:mpq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     ABA45_06860
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ABA45_06860
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     ABA45_06860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M XdhC_C Radical_SAM FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKO52179
UniProt: A0A0H4HZT1
Position
complement(1544659..1546119)
Genome map
AA seq 486 aa AA seqDB search
MDFLPLFFNLNDRQVLLVGGGDIALRKARLLKRAGVGLTVISHAVDEELRALLTDDRDEI
ILGDYHSDLLEGKTLVVAATDDAELHRQVHAEAVARNIPINVVDTPKLCSFIFPAIVDRS
PIVIGITSGGQSPVLARLLRARLETLIPKGYSSLGGLVGRFRDRVKARFNSLNDRRQFWE
NVLEGQIAEKVFSGRHDEAESMLVSAINRGDAGHKTGEVYLVGAGPGDPELLTFKALRLM
QQADVVFYDNLVSPGVLDLCRRDADLIYVGKRRDHHTVPQDDINALLVKHAKLGRRVVRL
KGGDPFIFGRGGEELEELKAHGIPFQVVPGITAASACSTYAGIPLTHRGYAQSVKFVTGQ
LKNRQQALDFKELIQPNQTVVFYMGLHTLPQISAGLMAHGRAPDTPIAIVSHGTSVDQKV
LIGTLADIATKQEQAQLPAPALIIVGNVVRLYEKLAWFGETAPSDNITHALGMVRSEARF
TEANVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggattttttaccactgtttttcaatttgaacgatcgccaggtgttactggtgggcggt
ggtgatatcgccctgcgcaaggctcgcctgctcaaacgcgcaggtgttggcctgactgtg
atttcccatgccgtcgatgaggaacttcgggctctactgaccgatgaccgagacgagatc
attttgggggattatcacagcgacctgctggaggggaaaaccttggtggtcgccgccacc
gacgacgccgagttacaccgtcaggttcacgccgaggcggtagcgcgaaatatccccatc
aatgtggtggatacgcccaagctgtgcagcttcatatttccggccatcgtcgaccgctcg
cccattgtgattggcattacctccggggggcagtcaccggtgctggcgcggctattaagg
gctcgcctggagacccttatccccaaaggctatagcagcctcggtggtttggtagggcgc
tttcgcgatcgggttaaggcgcgtttcaattcgctcaatgaccggcgtcaattttgggaa
aacgtgctggaaggacaaattgccgaaaaggtgttttccggtcgccatgacgaagccgaa
tccatgctggtgtcggccatcaaccggggcgacgctggtcataaaaccggcgaggtgtat
ctggtcggtgctggcccgggtgatccagagctgctgacgtttaaggcgctgcgtctgatg
cagcaggctgacgtggtgttttacgacaatctggtatcgccaggagtgctggatttgtgc
cggcgcgacgccgacctgatttacgtcggcaagcgtcgagatcatcacacggtgccgcaa
gacgacattaatgctctgctggtaaaacacgccaaactggggcggcgggtggtgcggctt
aaaggcggtgatccgtttattttcggacgcggcggtgaagaactggaagagctcaaagcc
catggcataccattccaggtggtaccgggcattaccgccgccagcgcgtgttcgacctac
gccggcattccactgacccaccgtggctatgcccaatcagtcaagtttgtaaccggccag
ttaaaaaatcgacaacaagccctcgatttcaaagaactgatacagcccaatcaaacagtc
gtgttctatatggggctgcacacactgccgcaaatcagtgccggcctgatggctcatggc
cgggcgccagatacaccgattgccattgtctcccacggtacctcagtcgatcagaaagtg
ctgattggcactttggccgatatcgccaccaaacaggagcaggctcagctgccggcgccc
gcgttgattattgtgggaaacgtagttcgcctttacgaaaagctggcttggtttggtgag
actgcgcccagcgacaacattacccacgccttgggcatggtgcgcagcgaggccaggttc
actgaggcaaacgtggcctga

DBGET integrated database retrieval system