KEGG   Marinobacter psychrophilus: ABA45_07030Help
Entry
ABA45_07030       CDS       T03980                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00620  Pyruvate metabolism
mpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABA45_07030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpq02000]
    ABA45_07030
Enzymes [BR:mpq01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     ABA45_07030
Transporters [BR:mpq02000]
 Other transporters
  Primary active transporters [TC:3]
   ABA45_07030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H YqfD
Motif
Other DBs
NCBI-ProteinID: AKO52210
UniProt: A0A0H4I3H0
Position
1582316..1584097
Genome map
AA seq 593 aa AA seqDB search
MTDIKKPLGITDVVLRDAHQSLLATRMRLDDMLPIAEKLDKVGFWSLESWGGATFDSCIR
YLGEDPWERIRELKKVMPNTPQQMLLRGQNLLGYRHYADDVVERFVDRAAENGVDVFRIF
DAMNDPRNLLTAIKAVRKTGKHAQGTIAYTTSPVHTIEMWVELAKEVADMGADSIAIKDM
AGILKPYVAFDLVSRLKKELDIPIHMQCHATTGMSTATAIKAAEAGIDNVDTAISSMSMT
YGHSPTEAVVAILEGTERDTGLDLVLLEEIASYFREVRKKYARFEGSLRGTDSRILIAQV
PGGMLTNMEGQLKEQNAAHRFDEVLAEIPKVREDLGFIPLVTPTSQIVGTQAVLNILTGE
RYKSISKETAAILKGEYGAAPAPFNKELQERVLDGKEVVTCRPADLIDSEMDKLTDELKK
LAEEKNFKLADNVIDDVLTYALFPQIGLKFLENRNNPDAFEPIPSADDVAPAKKVSGPET
YTVEVNSKKYVVAVSEGGEISQIQAEGGAASAPAAAASAPVGDGDPVNAPLGGNIFKVLV
SPGDAVEEGDVLIILEAMKMETEIRAPKAGTVGEVFIKVGDAVAVDDEMLTIA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgacagacattaaaaaaccgctggggattacggacgttgtactgcgtgacgcccaccag
tccttgctggccacccgcatgcggcttgacgacatgctgccaatcgccgagaaactcgac
aaagtcggcttctggtcactggaatcttggggtggagccacgtttgattcctgtatacgg
tacttgggcgaagacccctgggagcgtattcgtgaattgaagaaagtcatgcccaatacg
ccccaacagatgttgttgcgtggccagaaccttctgggctaccgccactatgcggatgac
gtggtagagcggtttgttgatcgtgccgctgaaaatggcgtggacgtattccgcattttt
gatgcgatgaacgatccccgcaacttgctcacggccatcaaggccgtgcgtaaaaccggc
aagcatgcccaaggcaccattgcctacaccaccagcccggtgcacaccatcgaaatgtgg
gttgagctggcgaaggaggtcgcggatatgggcgcggattccatcgcgatcaaggatatg
gcaggaattctcaagccctatgtcgcctttgatctggttagtcgtttgaagaaagaattg
gatattccgattcacatgcagtgccatgcgaccaccggcatgtcgaccgccacagctatt
aaagcagcggaagctggtattgataatgtggacacagctatatcctcaatgagtatgact
tacggccattcgccaacggaagctgtagtcgccattttagaaggtacggagcgtgacacc
ggtttggatctggtgttgctggaagaaattgccagttatttccgcgaagtccgtaagaag
tacgccaggtttgaaggcagccttcggggcaccgattcccgcattctaattgctcaggtg
ccgggtggcatgctgaccaatatggaaggccagctcaaagagcagaacgccgctcataga
tttgatgaagtactggctgaaattcccaaagtgcgtgaagacttgggctttattccgctg
gtaacgccgacctcgcagattgtcggcacacaggcggtactgaacatactgaccggtgag
cgttataaatctatttccaaagaaacggcggctatcctcaaaggcgagtacggcgccgcg
cctgcgccgttcaataaagagcttcaggagcgggttctggatggcaaggaagtcgttaca
tgccgcccagccgacctgattgactcggaaatggacaaactgaccgacgagctgaaaaag
ctggcggaagagaaaaacttcaagctggctgataacgtcatcgacgatgtgctgacttac
gccctgttcccgcagattggcctgaagttccttgaaaaccgcaacaatccggatgcgttt
gagccgattccgtcggcggacgacgtagccccagcgaaaaaagtctctggtcccgaaacg
tacaccgttgaagtaaacagtaaaaaatacgtggtagcggtgtctgagggtggcgaaatt
agccagattcaggcagaaggcggggctgcttcggcacctgcggccgctgcatcggcgccg
gttggtgatggcgatccggttaacgcgcccctgggcggtaacatcttcaaggttctggtt
tctcccggcgatgccgtggaagaaggcgatgtgttgatcattctggaagccatgaaaatg
gaaaccgagatccgcgcaccgaaagccggtaccgtcggtgaagtcttcatcaaggtcggt
gatgccgtcgctgttgatgatgaaatgctgacaatcgcataa

DBGET integrated database retrieval system