KEGG   Marinobacter psychrophilus: ABA45_09100Help
Entry
ABA45_09100       CDS       T03980                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00900  Terpenoid backbone biosynthesis
mpq01110  Biosynthesis of secondary metabolites
mpq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABA45_09100
Enzymes [BR:mpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     ABA45_09100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AKO52548
UniProt: A0A0H4I452
Position
2037424..2039703
Genome map
AA seq 759 aa AA seqDB search
MARIPEFYKLSVSQRVREVRKQGLLSNQDYQALASGNHTLSIQSADKMIENVIGVMGLPL
ALGLNFLINDKAYAIPLVVEEPSIVAALSSAAKIARAGGGFRVESSEPILIGQIQVVDVP
HPQRAKAALLQRKSEILNLANSLHPNMVARGGGAKDLQVLIHPSSGQRGDMVVAHLLVDT
CDAMGANLVNTMCEGVASLVENIAEGKVFLRILSNLTDRALVKARVSIPLDALAGRGFDG
EQVRDGIILANEFASIDPYRAATHNKGIMNGIDAVALATGNDWRALETGAHAWAARGSHY
TSLTQWTRGEDGSLEGELEIPIKVGIVGGALQSNPTAAMNLRLLGVSSARELAEVMGAVG
LAQNFSAIRALATEGIQQGHMTLHARSVAAAAGATPKIFETVVDRLIESGEIKIWKAREL
IEQAVSPRVKAAKEKPQSETATEERNVSSGHGKIILLGEHAVVYGRHAIATPIPLAIQAH
VQRGGDGVELIIPRWGVEQRLHRSAEKQHAYEKSLAIIFKTLGLERESMRLEIFPNVPRA
MGLGGSAAIAVATIRALDRCFELGLDDERVNELAFECEKIAHGTPSGIDNTLSTYGQTML
FRSGESPLRKVIEIDQAVQLVVGISGVESLTAATVSRVRKAREAHPELYETIFNQIDSLV
IEGVDALVGHKLETLGELMNICHGLLNAMQVSSWELEEMIQIARRHGALGAKLTGGGGGG
SIIALCPPEPGAADRIESGIREAGYQTIQVTMGGKPKNR
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaattcccgagttctacaaactttcggtttcgcagcgggttcgcgaagttcgc
aagcagggcctgctttcgaaccaggattaccaagcgctggctagcggcaatcacacgctc
tcgatccagtcggccgacaagatgatcgaaaacgtcatcggcgtcatggggctgccgttg
gcgctgggcctgaatttcctgatcaacgacaaggcatacgccattccactggtcgtggag
gagccttcgatcgttgcggcgctgagctctgcggccaagatcgcacgggccggcggcggc
ttccgggtcgaaagctccgagccgattttgattggccagatccaagtcgttgacgtaccg
catccgcagcgcgccaaggcggcactgttgcagcgtaaaagcgaaatcctgaaccttgcc
aacagcctgcacccaaacatggtggctcgcggcggcggggccaaggatctccaagtgctg
attcacccatcatcgggccagcgcggtgacatggtcgtcgcccacctgctggtggatacg
tgcgacgcgatgggcgcgaacctggtcaacacaatgtgcgaaggcgttgcctcactggtc
gagaatatcgccgaaggcaaggtgttcctgcggattctttcaaatctgaccgatcgagcc
ctggtcaaggcccgggtctcgattccgctggacgcgctggccggccgcggtttcgatggt
gagcaggtgcgcgacggaatcatcctggccaacgaatttgcctcgatcgacccctaccgt
gcggcgacccataacaagggcatcatgaacggaatcgatgccgtggcgctggccacaggc
aatgactggcgcgcccttgagacgggcgcccatgcctgggctgcgcgcggatcccactat
acgtcgctgacccagtggacgcggggcgaagacggctcgttggaaggcgagctcgagatt
ccgatcaaggtcggtattgtcgggggtgcgctgcagtccaatcccacggcggcaatgaac
ctcaggcttctgggcgtgagttcggcgcgcgagctggccgaagtgatgggcgcggtgggt
cttgcgcagaacttttcggcaatccgcgcgcttgcgaccgaaggcatccagcaaggccac
atgacgctgcacgcccgaagcgtggcagccgcggccggtgcaacaccaaaaatcttcgaa
accgtcgtcgaccggctgatcgaatccggcgagatcaagatctggaaggcgcgagagtta
atcgagcaagccgtcagccctcgcgtgaaggccgctaaggagaagccgcagtctgaaacc
gctaccgaggaacgcaacgtatccagcggacacggcaagatcatcctgttaggcgagcac
gcagttgtttacgggcggcatgcgatcgcgacgccgataccgttggccatacaggcgcac
gtgcagcgcggcggggacggcgtggaactgatcattccgcgctggggcgtagagcagcga
ttgcaccgaagcgcagaaaaacagcatgcttatgagaaatccttggcgattattttcaag
acgctcggactcgaacgcgaaagcatgcgtttggaaattttccccaacgtaccgcgagcc
atgggactgggcggatcggcggcgatcgcggtggccaccattcgcgcactggaccgttgt
tttgaactcggcctggatgacgagcgcgtcaacgagctggcgttcgagtgcgaaaagatc
gcacacgggacgccatcgggtatcgataacacgctctcgacctatggccagaccatgctc
ttccgttccggtgaatcgccgctgcgcaaggtgatcgagatcgatcaggccgtgcagttg
gtcgtcggtatcagcggtgtcgagagcctgaccgcggcgacagtctcgcgtgttcgcaag
gcacgcgaagcgcaccccgagctgtacgaaactatcttcaaccagattgattcgctggtg
atcgagggcgtggatgcgctggtcgggcacaagctcgagacgctgggagagctgatgaac
atttgccatggcctgctgaacgcgatgcaggtgtcgagctgggaactggaggaaatgatc
cagattgcccgccgccacggtgctctcggggcaaagctcaccggtggcggtggtggtggt
tccatcattgccctgtgtccgccggaacccggcgctgccgatcgaatagaatcgggtatc
cgtgaagccggctatcagacgattcaggttacaatgggcggtaagccgaaaaataggtga

DBGET integrated database retrieval system