KEGG   Marinobacter psychrophilus: ABA45_15030Help
Entry
ABA45_15030       CDS       T03980                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpq  Marinobacter psychrophilus
Pathway
mpq00071  Fatty acid degradation
mpq00072  Synthesis and degradation of ketone bodies
mpq00280  Valine, leucine and isoleucine degradation
mpq00310  Lysine degradation
mpq00362  Benzoate degradation
mpq00380  Tryptophan metabolism
mpq00620  Pyruvate metabolism
mpq00630  Glyoxylate and dicarboxylate metabolism
mpq00640  Propanoate metabolism
mpq00650  Butanoate metabolism
mpq00900  Terpenoid backbone biosynthesis
mpq01100  Metabolic pathways
mpq01110  Biosynthesis of secondary metabolites
mpq01120  Microbial metabolism in diverse environments
mpq01130  Biosynthesis of antibiotics
mpq01200  Carbon metabolism
mpq01212  Fatty acid metabolism
mpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABA45_15030
   00630 Glyoxylate and dicarboxylate metabolism
    ABA45_15030
   00640 Propanoate metabolism
    ABA45_15030
   00650 Butanoate metabolism
    ABA45_15030
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABA45_15030
   00072 Synthesis and degradation of ketone bodies
    ABA45_15030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABA45_15030
   00310 Lysine degradation
    ABA45_15030
   00380 Tryptophan metabolism
    ABA45_15030
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABA45_15030
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABA45_15030
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABA45_15030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpq04147]
    ABA45_15030
Enzymes [BR:mpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABA45_15030
Exosome [BR:mpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABA45_15030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKO53570
UniProt: A0A0H4I792
Position
complement(3308331..3309515)
Genome map
AA seq 394 aa AA seqDB search
MSDAVIVSTARTGLGKSYRGALNNTHSVDLAGHVIKHAVARAGIDPAIVEDVILGASFQE
GAQGRNMARLAAIRGGLPVTTAGLSINRFCSSGLQAIAIAAQRVVSEKVPAMVAGGVESI
SLVQNDKFNSFHATNEWLMKHKPELYMAMIETADIVAQRYNVSRESQDEYALISQQRTAA
AQEAGRFDDEIVPFEATMLVKDKETGEVSNKDVTLTRDECNRPSTTLDALQGLKAVRGEG
NFITAGNASQLSDGASVCTVMNSTYAEKNNIEPMGIFRGFAVAGCEPDEMGIGPVFAIPR
LLERNGLTMDDIDLWELNEAFASQVVYCRDRLGIPMEKLNVNGGSISIGHPYGVTGSRLA
GHALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgccgttattgtatctaccgcacggaccggtcttgggaagtcttatcggggc
gctttgaacaacactcacagtgtggatcttgccgggcatgtgatcaaacacgccgttgcg
cgtgcaggtattgaccccgctatcgttgaggatgtgattctcggcgcaagttttcaagaa
ggcgcacagggcagaaatatggctcgcctggcggctattcgtggtggcttaccggtgaca
actgcagggttgtcgatcaaccgtttctgcagctctggccttcaggctatcgctattgcg
gcgcaacgtgtggtttcggagaaggtgccggcaatggtggctggtggtgtggagtctatt
tctttggttcagaacgacaagttcaacagctttcatgcgaccaacgaatggctgatgaag
cataagcccgagctgtacatggcgatgattgaaacagcggacattgtcgctcagcgctat
aacgtcagccgtgaatctcaggacgaatacgccctgatctcccagcagcgtacggctgcg
gcgcaggaagccggcaggtttgacgatgagattgtgccgtttgaagccacgatgctggtg
aaagataaggaaactggcgaagtgagtaataaagacgtcactctcacgcgcgacgagtgc
aaccgcccgagtacgacgcttgacgcgctgcagggcttgaaggcggtgcgtggtgagggc
aattttatcacggcaggtaatgccagccagttgtctgacggtgcgtctgtgtgcacggta
atgaacagcacctatgccgagaaaaacaatatcgagcctatggggattttccgtggtttt
gcagtcgcagggtgtgagccggacgagatgggtattggcccggtgtttgccattccgcgt
ctgctggagcgtaacggcctgaccatggatgacatcgacctttgggagctgaacgaagca
ttcgcgtctcaggtggtgtactgccgtgatcgtttaggcattccgatggaaaaactgaat
gttaacggtggctctatttctatcggtcacccttacggtgtcactggttctcgccttgcc
ggtcacgccttgattgaaggcaaacgtcgcggcgccaaatacgttgtggtgaccatgtgc
attggtggtggccagggtgctgcaggtttgtttgaagtggtttga

DBGET integrated database retrieval system