KEGG   Moniliophthora perniciosa: MPER_02630Help
Entry
MPER_02630        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00040  Pentose and glucuronate interconversions
mpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPER_02630
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MPER_02630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: EEB97952
UniProt: E2L9E9
AA seq 188 aa AA seqDB search
MYNVNIANTYGPGKQATALSAKNSNQGYYGCKITGYQDTLLADGPGYQYYSNCYIEGAVD
YIYGKASAWFGECTLSSNDSGAITANSRESSSDPGYYVIDSSTITSSVSGLTQKVYLGRP
WRALARVSFQRSTLPDLINPKGYTTLADNATPIFMEYQNTGTGADTSQRVTFTKQTALLT
HEQVLGSD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatgtcaacatcgccaatacctacggaccgggaaagcaggccaccgccctgtcg
gcgaagaactccaatcaaggctactatggctgtaagataacaggataccaggacaccctc
ttggcagacggccccggatatcaatattattccaactgctacatcgaaggtgcagtcgac
tacatctacggcaaggcttccgcgtggtttggtgaatgtacactttcctccaatgactct
ggcgctatcacagccaactcgagagaatccagcagtgatcctggatactatgtgatcgat
agctcaacgatcacgagctcagtttcgggtttgacccagaaggtttaccttggacggcca
tggagggctctagcacgagtctctttccagcgttcgactctcccggatctgatcaaccca
aagggctacacaacattggcggataacgcaactccgatcttcatggagtatcagaacact
ggcaccggtgcagacacgtctcaacgggtgacgttcacaaagcagacggcacttctgacc
cacgagcaagtgctaggatcggattag

DBGET integrated database retrieval system