KEGG   Moniliophthora perniciosa: MPER_02838
Entry
MPER_02838        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00100  Steroid biosynthesis
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MPER_02838
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MPER_02838
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-ProteinID: EEB97774
UniProt: E2L9X7
AA seq 311 aa
MAAAPKSSQKAPAAELNPRTTEYDFFGPIGALTVTITVPIIVYALYFGCAEETGGCPPKF
ELQDLVSYFSREQWWKNLWDTDAAIAYLGWYAFCVVCWIILPGGTLEGAVLRDGSVKEYK
INGKFSYLFDLYASNSLLLQVSLLLCSLXDSHLALFISTGRNPMTLSTTMAIYVYAMSFR
PGKLLALGGNSGNIIYDFFIGRELNPSIGSFDIMSFNELSPGLILWALIDISMICEQAVR
RGGYAKVTDSMWLASAFQIWYVADALYNEPALFTTIDIVTDGIGYYAYRWRSIMGAFHVL
TTNSIPCLQTS
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcggcagcacccaagtcgtcacagaaggctcctgcagcggaactaaacccacgcacc
accgagtatgacttttttggacccattggcgcgctcaccgtcaccattaccgtccccatc
atcgtttacgccctctactttggatgtgctgaagaaactggaggctgcccgcccaaattt
gaacttcaagacttggtatcttacttcagccgtgaacaatggtggaaaaacctatgggat
acagacgcagcaatcgcgtaccttggttggtatgcgttctgcgtggtatgctggattatc
ctaccaggagggacccttgaaggagcggtactgcgagatggaagcgtgaaagagtacaaa
attaatggcaagttctcgtatctgtttgacctgtatgcttctaacagcttgttactccag
gtttcgctacttttatgctcgctgntggactcgcacttggctctatttatcagtacggga
cggaatcccatgaccttatctaccacaatggctatctacgtctatgccatgtcgttccgc
cccggaaaactgcttgctctaggaggaaactctggcaacatcatttatgactttttcatc
gggagagagctcaatccgtctattggctcgtttgacatcatgtccttcaacgaacttagt
ccgggcctcattctctgggctcttatcgacatatccatgatctgcgagcaggctgttcgt
cgtggcggatacgcaaaggttacagattcaatgtggctcgcttcggctttccagatctgg
tacgtggccgatgccttgtataacgagcccgcactattcactactatcgatatagtgact
gatggtatcggctattatgcttaccgttggcgatctattatgggtgcctttcacgtactc
actacaaactcgataccttgtttacaaacaagttga

DBGET integrated database retrieval system