KEGG   Moniliophthora perniciosa: MPER_03004Help
Entry
MPER_03004        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00010  Glycolysis / Gluconeogenesis
mpr00071  Fatty acid degradation
mpr00350  Tyrosine metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_03004
  Lipid metabolism
   00071 Fatty acid degradation
    MPER_03004
  Amino acid metabolism
   00350 Tyrosine metabolism
    MPER_03004
Enzymes [BR:mpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MPER_03004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-ProteinID: EEB97639
UniProt: E2LAB2
AA seq 129 aa AA seqDB search
MTIDIPKTAKAAVINEFNRPLDLQDWPVKQPSELAPGECLIKLAFAGCCHSDLHVKENEW
GFSAKLPLVGGHEGIGHIVAIGEHTINSPVKIGDRVGLKWIASSCLRCEMCKKXKEARSH
GFTGHRDFC
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgactattgatattccaaagaccgccaaggctgctgtcattaacgagttcaacagaccg
ctagatcttcaagattggccagtcaagcaaccttccgagcttgcacccggagaatgtctt
atcaagctggcctttgctggatgttgtcattcggacttgcatgtcaaggagaacgaatgg
ggtttctcagcgaagcttcctctggtgggaggacacgaaggcattgggcatattgtagcg
atcggggagcatactatcaacagtccagtcaagattggtgatagagttgggttgaagtgg
atcgcatcctcgtgtttaaggtgtgaaatgtgcaagaaggnaaaagaagctcgtagccac
ggcttcaccggacaccgggacttttgctga

DBGET integrated database retrieval system