KEGG   Moniliophthora perniciosa: MPER_05682Help
Entry
MPER_05682        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00010  Glycolysis / Gluconeogenesis
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPER_05682
Enzymes [BR:mpr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     MPER_05682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: EEB95359
UniProt: E2LGU2
AA seq 253 aa AA seqDB search
MPVEKNDDGIVLKHPKASIPDVLIASGLMNWKGPSVEILLYGAHILSWKSGTKGDAKQTE
RIFLSSKALLDGSGPVRGGIPLVFPAFGAPPHAHPEHVKLGQHGFARTLAPTPKIQEVYS
RPFQLAFVVTLGEHQLSTDLHVHNPAPEPLEFQALLHNYIRCPSNDVTIAPLQGKQYFDK
TDMGHQGLKTEMRAAVDVRKWTDSVYEDTSGSYEITWPGGGVSIKTVNLKDLVIWNPRSE
AGSKIVDMEDGGW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgccggtagaaaagaatgacgacggaattgtgttgaagcacccaaaggcaagtatcccc
gatgttctcatcgcgtctgggctgatgaattggaagggtcccagcgtggagatactctta
tatggagctcatatcttgtcttggaaatcgggaactaaaggtgatgccaaacaaacggaa
cgcattttcttatcgtcaaaggcgctgctcgatggctccggccccgtacgagggggtatc
ccactggtattccctgcatttggtgcaccacctcatgctcatcccgagcatgtcaaattg
ggacagcacggatttgcgaggacgcttgctccgacaccaaagatccaagaggtgtactcc
aggccattccagctggcctttgtggtaacgcttggagagcaccagctgagcaccgacctc
cacgtccataatccagcgcccgaacccttggagttccaggccttgttacacaactacatt
cgatgcccatccaatgatgtgacaatagcaccgctccaaggcaagcagtactttgacaag
actgatatggggcatcaagggttgaagacggagatgcgggctgctgtggatgtacggaaa
tggacagatagtgtgtatgaggacacatctgggagttatgaaataacctggcctggagga
ggcgtcagtatcaagacggtgaatctgaaggacctggtcatctggaatccgcgatcagaa
gctggctcaaagatagtcgatatggaagatggagggtggtga

DBGET integrated database retrieval system