KEGG   Moniliophthora perniciosa: MPER_07542Help
Entry
MPER_07542        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00052  Galactose metabolism
mpr00500  Starch and sucrose metabolism
mpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MPER_07542
   00500 Starch and sucrose metabolism
    MPER_07542
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MPER_07542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N
Motif
Other DBs
NCBI-ProteinID: EEB93762
UniProt: E2LLD9
AA seq 287 aa AA seqDB search
RHLRPRFIKPGGVNDPLAVFDGTVIAWTLPYTPGSEAQAIAVSNGTGYTFEKLERGPVIA
SAPFGLNVTGWRDPFSFQDLEFDKLLNSTKDSWYIIISGGEHEVGPALFLYRKHDVDFME
WEYLANTTWGEGIWSGRWGYNFEVGNVFRVGADGIDPKGTLFSLVGTEGGKYGIQGGRAQ
LWAAGDLEPPTHETVSFKVTMAGVLEWGSAAYAASGKVVHASSKPSQACGAPDRYIVWLW
LTGTFYDSTPFPIEPQGWDSSLLTPRELTSXHPHVVDNAVLRDRSWK
NT seq 866 nt NT seq  +upstreamnt  +downstreamnt
gccgtcacttacgtcctcgcttcatcaaacccggaggcgtcaacgatcctctcgccgtgt
ttgacggaacagtaattgcctggaccttaccatatactccaggaagcgaggctcaggcaa
ttgcagtttcaaatggcactggctatacctttgaaaaactggaaagggggccagttatcg
cttcggcaccttttggtttgaacgtcactggctggagagatccgttctctttccaagacc
tagaatttgacaagctactaaacagcacgaaggacagttggtacataatcatttctggtg
gtgaacacgaagtgggacctgccctattcctctaccgcaagcatgatgttgacttcatgg
aatgggaatatctcgcaaacaccacctggggcgagggcatctggtcgggtcgttggggat
ataatttcgaagtcggaaacgtcttccgggttggagccgatggcattgatcctaagggaa
ctctattcagtctggtcggcacagagggcgggaagtatgggatccaaggaggcagagctc
aactctgggcggctggcgatctggagccacccactcacgaaactgtttcgttcaaggtta
cgatggccggcgtgctggaatggggatcggctgcctacgctgcttccggcaaagttgttc
acgccagctctaagccttctcaagcatgcggtgcaccagatcgctatattgtgtggctct
ggctcaccggtacattctacgactcgactcctttccccatcgagccacaaggctgggata
gctcattgttgaccccacgtgagcttacgtcgnaacatccacatgttgtcgacaacgccg
tgttacgagaccgttcgtggaagtag

DBGET integrated database retrieval system