KEGG   Moniliophthora perniciosa: MPER_08697Help
Entry
MPER_08697        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
mpr  Moniliophthora perniciosa
Brite
Enzymes [BR:mpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     MPER_08697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase Rox3 Ribosomal_L7Ae Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: EEB92750
UniProt: E2LPA1
AA seq 141 aa AA seqDB search
MATRLSEASQYTQLLDAYDTWMFDCDGVLWHGDRVIPGATDVLSLLRQRGKKVIFVTNNA
TKSRKSYKGKFDSLGVEAKVDEIYGSAYAAAVYISSVMKLPKTKKVYVIGMKGLEEELTD
EGVSFIGGTLIAPSDLLPLGS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggccactagattatcggaagcttcgcaatatacccaactattagatgcatacgatacc
tggatgttcgactgcgatggtgtcctctggcatggagatcgtgttatacccggtgcgact
gatgttttatctctgctccgccaacgaggaaaaaaagtaatctttgtcacaaataatgca
acgaaatcgagaaagagttacaagggaaagtttgattcgctgggtgtcgaggccaaagta
gacgagatatacggctcagcatatgcagcggcagtatacatctcatcggtgatgaagttg
cctaaaaccaagaaagtctatgttattggcatgaaagggcttgaagaggagttgaccgac
gaaggtgtatcgtttattggtggaacactgatagcaccctcggaccttctccccctagga
tcctag

DBGET integrated database retrieval system