KEGG   Moniliophthora perniciosa: MPER_09545Help
Entry
MPER_09545        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K08738  cytochrome c
Organism
mpr  Moniliophthora perniciosa
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: EEB92006
UniProt: E2LRE4
AA seq 85 aa AA seqDB search
MPYAAGVFNSNPAHSHIFGRKSGQVDGFSYTAANVNKGVTWDEHTFLEYLENPKKYIPGT
KMAFAGLKKEKDRNDLITYLKEATA
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgctgccggtgtgttcaactcaaaccctgctcattctcatatttttggccgc
aagagtggacaagtagatggcttttcatataccgctgccaacgtcaacaagggtgttaca
tgggacgagcacacattcttggagtacctcgaaaaccccaaaaagtatattcctggaacg
aagatggcattcgctggcttgaagaaggaaaaggacaggaatgacctaatcacctacttg
aaggaagctaccgcctaa

DBGET integrated database retrieval system