KEGG   Moniliophthora perniciosa: MPER_11085Help
Entry
MPER_11085        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00020  Citrate cycle (TCA cycle)
mpr00640  Propanoate metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MPER_11085
   00640 Propanoate metabolism
    MPER_11085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpr04147]
    MPER_11085
Enzymes [BR:mpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MPER_11085
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MPER_11085
Exosome [BR:mpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPER_11085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: EEB90675
UniProt: E2LV76
AA seq 227 aa AA seqDB search
LEVAKKLGFKDASTQDEAADIFINLYRIFKEKDATQIEINPMAETKDGKVLCMDAKFGFD
DNAEFRQEDIFALRDISQEEPSEVEAQKANLNFIKLDGSIGCLVNGAGLAMATMDVLSLH
GGNPANFLDVGGGATPETVKKAFEILLADTKVKSIFINIFGGIMRCDYIAEGVIKATKEL
NMTIPLVVRLKGTKEQEAKDMIKESGLKTMHSDGLDEAAERAVQLAN
NT seq 686 nt NT seq  +upstreamnt  +downstreamnt
ctctcgaggttgcaaagaagctcggcttcaaagatgcttccactcaagatgaagctgctg
acatcttcatcaacctttatcgcattttcaaagagaaggatgccacacaaatcgaaatca
atcccatggcagaaaccaaggacggaaaggttctttgcatggacgctaaattcggtttcg
acgacaatgcagagttcaggcaagaagacatcttcgcacttcgtgacattagtcaggaag
agccatctgaggtcgaagcgcaaaaggctaacctcaatttcatcaaattggatggaagta
ttggatgcttggttaatggtgccggtcttgccatggctactatggacgtcctttcactcc
atggtggcaaccccgccaactttcttgatgttggaggaggtgctactcccgagaccgtga
agaaggcattcgagattctcctcgctgacaccaaagtcaagagcatcttcatcaatatct
ttggaggtatcatgcgttgcgactatattgctgagggtgtcatcaaggctactaaagaac
taaacatgactattcctctggtcgtccgattgaagggtacgaaagagcaggaagccaaag
atatgatcaaggaatctggcttgaagaccatgcattccgatggtttagacgaggcagcag
aacgtgctgtccaacttgctaactag

DBGET integrated database retrieval system