KEGG   Moniliophthora perniciosa: MPER_12266Help
Entry
MPER_12266        CDS       T01089                                 

Definition
(GenBank) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mpr  Moniliophthora perniciosa
Pathway
mpr00020  Citrate cycle (TCA cycle)
mpr00640  Propanoate metabolism
mpr01100  Metabolic pathways
mpr01110  Biosynthesis of secondary metabolites
mpr01130  Biosynthesis of antibiotics
mpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MPER_12266
   00640 Propanoate metabolism
    MPER_12266
Enzymes [BR:mpr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MPER_12266
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MPER_12266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: EEB89615
UniProt: E2LY86
AA seq 169 aa AA seqDB search
AVRETQPDATILYVPPPTAADAIIEAIENEIGLIVCVTEGIPQADEIRVMHALKSQSKSR
LVGPNCPGVINPEGCKMGIQPGHIHKPGKIGIVSRSGTLTYEAVAQTTGVGLGQSLCLGI
GGDPFPGTQHVDGIKVFLEDPKTEGIVIIGEIGGTMEEEAAEYLEKYNK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gctgtccgagaaacccaacccgacgctaccatcctctacgttcctccacccaccgccgcc
gacgctatcatcgaagctattgagaacgagattggcctcattgtctgtgtgacagaagga
atcccccaggcggatgaaatccgtgttatgcacgcattgaaaagtcaatcaaagtccagg
ttagtcggccccaactgcccaggtgtcatcaaccccgaggggtgtaagatgggtattcag
cctggtcacattcacaaacccggcaagattggtatcgtgtcgcgttctgggactctgaca
tacgaggctgtagcccaaacaactggtgttggtctcggacagtccctttgcctaggcatt
ggtggtgatcctttccctggtactcaacatgtggacggaattaaagtcttcctcgaggat
cccaagaccgaaggtatcgtgatcatcggagagattggtggaaccatggaggaagaagct
gctgagtacttggaaaagtacaacaaa

DBGET integrated database retrieval system