KEGG   Moorea producens: BJP34_02750Help
Entry
BJP34_02750       CDS       T04499                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
mpro  Moorea producens
Pathway
mpro00330  Arginine and proline metabolism
mpro00360  Phenylalanine metabolism
mpro00380  Tryptophan metabolism
mpro00627  Aminobenzoate degradation
mpro00643  Styrene degradation
mpro01100  Metabolic pathways
mpro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BJP34_02750
   00360 Phenylalanine metabolism
    BJP34_02750
   00380 Tryptophan metabolism
    BJP34_02750
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BJP34_02750
   00643 Styrene degradation
    BJP34_02750
Enzymes [BR:mpro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BJP34_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOW98506
UniProt: A0A1D8TLN4
Position
670332..671966
Genome map
AA seq 544 aa AA seqDB search
MKQKLTWWQIAKQGLTYLFMFALSAFPSEVVAETFRLREATIAEITRAFEKNALTSEQLV
QLYLNRIKAYDDQGPKINGLISINNNALKEARALDQERQQKGPRSPLHGIPIILKDNYDT
TDLPTTGGSVLLEGSLPPDDAFTVKKLREAGAIILGKANMSEFAESYGRLGYSSLGGLTR
NPYKLTRDPSGSSGGSGAVIAANFAVLATGSDTSGSIRGPAAVAGLVGIKPTQGLVSRDG
IIPLTLSFDSAGPMARTVTDAAIALGVMAGVDPNDYRTLESEGKTYKDYTQFLNKKALKG
ARIGVAIDFRGGNPEVDAATDAAIAKLRELGATVESVDFSPKLENLWPFMEEVTEAEFEP
QIDSYLKNLQLPFPDTLREMYSMSLSNPLVNSEQALNPGRIGGFGESLKHPELADPEYLY
ILHFEFPRVRQEILSIMSAQNLDAIIWPTMTCPAGPLYNVEDPTYQCASSDPYIPGYLAN
VSGFPGISVAMGFTEQGLPLGLTFFGKPYSEPTLLGFAYAYEQATQFRRPPTTTPALPGE
NFDY
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaactgacctggtggcaaatagctaaacaagggctgacttatcttttcatg
ttcgctctgagtgcttttccctcagaggtagtcgctgagacctttcgtctcagggaagca
acaatcgcagagataacccgtgcttttgagaagaatgcactcacttccgaacaattagtg
caactttatctcaatcgtattaaagcctatgacgatcaaggtccgaaaattaatgggcta
atttctatcaataacaatgctcttaaagaagcaagggcgttagaccaagaacgccagcag
aaaggaccgcgaagtcctttacatggcatccccatcattctgaaagataactatgacact
accgatttacccacaacaggaggatcggtgctgctggaaggttccttaccccccgatgat
gcttttactgttaaaaagttgcgagaggcaggagccattattcttggtaaagcaaacatg
agtgaatttgctgaatcctatggtaggctaggttacagttcccttgggggactgacacgc
aatccctacaaattaactcgtgatccttcgggctcgagtggaggcagtggggctgtaatt
gcggcaaattttgctgttttagccaccggaagcgatacttcaggctcaattcgtggccct
gcagcagtagcaggtcttgtcggtatcaaacccactcagggactggtgagtcgggatggt
attatccccctaaccctctcctttgatagtgcaggccctatggctcgaaccgtgacagat
gcagcgatcgctttgggtgtaatggcaggggttgatcccaatgattaccgtaccctggaa
agtgaagggaaaacatataaggactacacgcagtttctcaataaaaaagccctaaaaggg
gcaagaattggggtggcgattgattttcggggtgggaaccctgaggtagatgctgcaact
gatgcagcaattgctaagctgagggaattaggtgcaacagttgagtcggtggatttctct
cccaaattggaaaacctctggcctttcatggaagaggtaacagaggctgagtttgaaccc
cagatcgatagttacctcaaaaacctccagcttccattccctgacaccctgagggaaatg
tattcgatgagcttatctaacccattagtcaattcagaacaggctctcaatcctggtcgc
atcggagggtttggagagtctctaaagcatccagaactggctgatcccgaatatctttat
attctccatttcgagtttcctagggttcgccaggagattttatcgattatgagtgcccaa
aatctcgacgcgattatttggcccaccatgacttgtcctgcgggtcccctctataatgtc
gaggatccaacctatcaatgtgcctcaagtgacccctacataccagggtacttagccaat
gtttctggttttcccggcatttctgtggcaatgggctttactgagcagggattaccccta
ggactgactttctttggtaagccttacagtgagcctaccttactgggattcgcttatgct
tacgaacaggcaacccagtttcggcgacctccaacaaccactcctgctttgcctggtgaa
aattttgactattag

DBGET integrated database retrieval system