KEGG   Moorea producens: BJP34_13345Help
Entry
BJP34_13345       CDS       T04499                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mpro  Moorea producens
Pathway
mpro00520  Amino sugar and nucleotide sugar metabolism
mpro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BJP34_13345
Enzymes [BR:mpro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BJP34_13345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR NmrA
Motif
Other DBs
NCBI-ProteinID: AOX00307
UniProt: A0A1D8TRS3
Position
complement(3558257..3559192)
Genome map
AA seq 311 aa AA seqDB search
MRILVTGGAGFIGSHLIDRLMAEGHEVICLDNFYTGHKRNILKWLSHPYFELVRHDITEP
IRLEVDQIYHLACPASPVHYQYNPVKTIKTNVMGTLYMLGLAKRVKARFLLASTSEVYGD
PDVHPQSEDYRGNVNPIGIRSCYDEGKRVAETLAFDYHRQNGVDIRVARIFNTYGPRMLE
NDGRVVSNFVVQALKGEPLTVYGDGSQTRSFCYVSDLVEGLIRLMNNDHTGPINLGNPGE
YTILELAQAIQKMVNPDTEIIFKPLPQDDPRRRQPDISKAKTLLGWEPTIPLSEGLDLTV
SDFRKRLTPQE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcctagttactggtggggctggttttatcggctcccatctaattgatcgtttg
atggcagaaggtcatgaagttatttgtctggataacttctatactggccacaaacggaat
atcctcaaatggctgtcacacccctactttgagttggtccgtcacgacatcactgaaccg
attcggttagaagttgatcaaatataccaccttgcttgtccagcatccccagttcactac
cagtacaatcctgtcaagactatcaaaaccaatgtcatgggtaccctatacatgctaggg
ttagccaaacgggtgaaggcgagattcttattagcgtccacgtctgaggtatatggggat
cctgacgtccatccccagtcagaagattatcggggtaatgtcaatcccattgggatccgc
agttgttacgatgaagggaagcgagtggcagaaaccctcgcatttgactaccatcgacaa
aatggtgtagacattcgtgtagctcgcatttttaacacctacggtcctcgaatgctggaa
aatgatgggcgagtcgttagcaattttgtggtgcaagctctgaagggggaacccttaacg
gtttatggggatggttcacagacccgaagtttctgctatgtctccgacttagtggaagga
ctaattcgacttatgaataatgaccataccggaccgattaatctcggaaatcctggagaa
tacactatattagaactcgctcaggcaattcagaaaatggtgaatcctgatacagaaatt
atctttaagcctctacctcaggatgacccccgacgtcgtcaaccagacattagtaaagct
aaaactttactaggttgggaacctactattcctttgtcagaagggttagatttgacagta
tccgatttccgtaagcgtttaactcctcaagagtaa

DBGET integrated database retrieval system