KEGG   Metallosphaera prunae: DFR88_01310Help
Entry
DFR88_01310       CDS       T05966                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mpru  Metallosphaera prunae
Pathway
mpru00620  Pyruvate metabolism
mpru00630  Glyoxylate and dicarboxylate metabolism
mpru01100  Metabolic pathways
mpru01110  Biosynthesis of secondary metabolites
mpru01120  Microbial metabolism in diverse environments
mpru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DFR88_01310
   00630 Glyoxylate and dicarboxylate metabolism
    DFR88_01310
Enzymes [BR:mpru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DFR88_01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase RRXRR
Motif
Other DBs
NCBI-ProteinID: QCO29297
UniProt: A0A4D8RWC6
Position
complement(299167..301779)
Genome map
AA seq 870 aa AA seqDB search
MTDQVKVEIDPLVKERYGVLFGNKNVNGKVVNVEQVIGELTLELRGEIERAMWERRKLLD
SRREVRDKYSFPPMEEKFTHPVTGEVRTFREIVQGLIDNLLDRNTPLRWRLNENLPVPPE
VDPFKVPGLEITGPWNPVDMAIKQINADVSATMGPDDEDAAPPDFIPFGSQEKEVGLYLS
RVNEHMILSGEISEVEITKKGERRKYRINKPRERWPTSIHRVPGMHLLDFHVKVNGKPAP
SIIVDYVIHVLNDFEPLRKRGSLLYFYQPKVQFPEEASIIAKILWKLERILGAEKPGTLI
KMKALYEEGNAGRFLPVIMWYWRFWLVGLNVGRWDYTASLIEMWNQRVLPDPQNGPLMGM
TARHMMAYQRYNAILNIMAGGSPIGGMNAVMLYAENDPYGRARHNPVTLRSMWLDKMRER
LVGLIFVPEGEVESVTLEDILSGKVKGKLYDGYRQSWVASPDERYVSAGNLPLRAPLEKL
QAMLVAPEEWETVDGKRVAPKVSSGLTESERKLFISLGLLNEKGKITPFVLRDMTPEGFL
KLLGGDLWDALYNIPPGEITVENIQHAFYMAANYGFQILNGNLAAAIDDYVLFPGRVVRF
MNDLATYRIFVTWLWTVVQHEPAVTKDGWLKGPKLTEDGVIPADPVIQLKAGERFTKEHF
QKLWELHNQWTRAFFEEYDRLTAIRIVASIISKRTGINVDKLVQAMIRGEAEKLVGHQTE
IGAIPRIREIVSKAYGAYPRYVREISLEEASHKISEIVGNHELVRRELESMQPRFDRSKA
PLIMDVLRRQMLCPNLIQHSGRVLFIIADKDESTREKILEAVYYLDREGRPLFRDMGRPS
RVLLARAVEEGKMPKYALEAHDYVYDIPES
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcaggtaaaggttgagatagatcccctggttaaggagaggtacggtgttctc
ttcgggaataagaacgttaatggaaaggtagtaaacgttgagcaggtcataggggaacta
accctcgaactgaggggagaaatagagagggccatgtgggaaaggaggaagctactggac
tctcggagagaggttcgagataaatactcattccccccaatggaggagaagttcacacat
ccagtcacgggagaagtgaggacatttcgtgagatagttcagggactcatagacaatctt
ctggacaggaacactcccctcaggtggaggttaaacgaaaacctcccagttcctccggag
gtggatccattcaaggtacctggtctggaaattacgggaccttggaaccccgtggacatg
gccataaagcagataaatgcagacgtttccgcaaccatgggaccagatgacgaggacgcg
gctccgccagacttcattcccttcggttcgcaggagaaggaggtggggctctacctctca
agggtcaacgagcacatgatactatctggggagatctctgaggtcgagataacgaagaag
ggcgaaaggaggaagtataggattaataagcctagggagaggtggcccacgagtattcat
agggttccggggatgcacttactagactttcacgtaaaggtcaacggaaaacctgcgccg
agcataatagttgactacgtgattcacgtccttaatgacttcgagcccttgaggaagagg
ggttcgttactctatttctatcagccaaaggttcagttcccagaggaggcctccataatc
gccaagatactctggaaactcgagaggatcctgggggcagaaaaacctggaaccctgatc
aagatgaaggcgctctacgaggagggtaatgcgggaaggttcctccccgtcatcatgtgg
tattggcgcttctggcttgtgggacttaacgttgggaggtgggactacactgccagcctg
attgagatgtggaaccagagggtcctgcctgatccccagaacggtccgctcatgggaatg
accgcgaggcatatgatggcctatcagaggtataacgccatcctcaacatcatggcaggg
ggatcgcccattggtggaatgaacgcggtcatgctttatgctgagaatgatccctatggg
cgagctagacacaaccctgttaccttgaggtccatgtggttagacaaaatgagggagaga
cttgtgggactaatcttcgtgccggaaggtgaagtggagagcgtgacccttgaggacatc
ctgtcaggaaaggttaaggggaagctctatgacggttataggcagagctgggtagcgtct
ccagacgagaggtacgtgagtgctggcaacttacccctgagggcgcctctggagaagcta
caggccatgctcgttgcccctgaggagtgggagaccgtggatgggaagagggtggcccct
aaggttagcagtggactcaccgagtcggagaggaaactcttcatctccctgggtcttctg
aacgagaaagggaagattacccccttcgtgttgagggatatgacgcctgagggtttccta
aagttgctgggaggagacctttgggatgccctttacaacataccgccaggggagatcacg
gtggagaacattcaacacgcgttctacatggcggcaaactacggcttccaaatactaaat
ggaaacctggccgcggccatcgacgattacgtcctcttccctgggagggtggtgaggttc
atgaacgaccttgcaacctacaggatctttgtgacctggttgtggacagtagtccaacat
gagcccgcagtgaccaaggacggatggctcaagggtccaaaacttacggaggacggagtc
attcctgcggatcccgtgattcagctcaaggccggagagagattcaccaaggagcatttc
cagaaactctgggaactgcacaaccagtggaccagggcattctttgaggagtacgacagg
ctgaccgcaattaggatagttgcctccataatatccaagagaacagggattaacgttgat
aagttggttcaggccatgatcaggggagaggcagagaagttagtgggacatcagaccgag
attggggcgatccccaggattagggagattgtgtccaaggcctatggtgcatatcctaga
tatgtaagggagatctcgctagaggaggcatcccacaagatctcggaaatcgtggggaat
catgagttggtgaggagggaactggagagtatgcaacctagatttgacagatcgaaggca
cccctaataatggatgtcttaaggagacagatgctgtgccccaacttgatacaacacagc
gggagagtcctcttcatcatagctgacaaggacgagagtaccagggagaagatcctcgag
gcagtttactatctggaccgggagggtaggccgttattcagggatatgggtaggccgtca
cgcgtgctattggcgagagcggtagaggaaggtaagatgcccaaatacgcgctagaggcc
catgattatgtatatgatataccggaatcctga

DBGET integrated database retrieval system