KEGG   Melissococcus plutonius ATCC 35311: MPTP_0235Help
Entry
MPTP_0235         CDS       T01492                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
mps00010  Glycolysis / Gluconeogenesis
mps00260  Glycine, serine and threonine metabolism
mps00680  Methane metabolism
mps01100  Metabolic pathways
mps01110  Biosynthesis of secondary metabolites
mps01120  Microbial metabolism in diverse environments
mps01130  Biosynthesis of antibiotics
mps01200  Carbon metabolism
mps01230  Biosynthesis of amino acids
Module
mps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mps_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_0235
  Energy metabolism
   00680 Methane metabolism
    MPTP_0235
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPTP_0235
Enzymes [BR:mps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MPTP_0235
Membrane trafficking [BR:mps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MPTP_0235
Exosome [BR:mps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MPTP_0235
  Exosomal proteins of melanoma cells
   MPTP_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAK20733
UniProt: F3Y8A5
Position
complement(242932..243618)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGMSEWNALNQFTGWVDVNLSPEGIEEAKEGGRKIKEAGIDFDIAYTSVLTR
AIKTCNLILEYSDQLWVPQVKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTL
PPLLEEMDPGSALNDRRYAGLDKRDIPAGENLKVTLERALPFWQDHIAPSLVDDKTVLVA
AHGNSIRALVKHIEGISDDDIMGVEIPTGQPLVYELNTDLSVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggaatgagcgaatggaatgcattaaatcaattt
accggttgggttgatgttaatttatcacctgaaggaattgaagaagcaaaagagggtgga
cgaaaaatcaaagaagctggaattgattttgatattgcctatacttctgtcttaacacgt
gcaattaaaacgtgtaatttaattttagaatattctgaccaactatgggtacctcaagta
aaatcttggcgcttaaatgaacgtcattatggtaaattacaaggcttaaacaaaaaagaa
acagcagaaaaatatggagacgaacaagtacatatctggcgtcgttcttatgatacactg
cctccattattagaagaaatggatccaggttctgccttaaatgatcgtcgctatgctgga
ctggacaaacgtgatattccagctggagaaaatttaaaagttacattggaacgtgcttta
cctttctggcaagatcatattgctccttcattggtagatgacaagactgttttagttgcc
gcacatggtaattctatacgggctcttgttaaacatattgaaggtatttctgatgatgat
attatgggtgtagagattccaacaggtcaaccacttgtttatgaactaaacactgactta
tctgtagctaaaaaatactatctataa

DBGET integrated database retrieval system