KEGG   Melissococcus plutonius ATCC 35311: MPTP_0880Help
Entry
MPTP_0880         CDS       T01492                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
mps00010  Glycolysis / Gluconeogenesis
mps00051  Fructose and mannose metabolism
mps00562  Inositol phosphate metabolism
mps01100  Metabolic pathways
mps01110  Biosynthesis of secondary metabolites
mps01120  Microbial metabolism in diverse environments
mps01130  Biosynthesis of antibiotics
mps01200  Carbon metabolism
mps01230  Biosynthesis of amino acids
Module
mps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mps_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPTP_0880
   00051 Fructose and mannose metabolism
    MPTP_0880
   00562 Inositol phosphate metabolism
    MPTP_0880
Enzymes [BR:mps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MPTP_0880
Exosome [BR:mps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MPTP_0880
  Exosomal proteins of bladder cancer cells
   MPTP_0880
  Exosomal proteins of melanoma cells
   MPTP_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK21342
UniProt: F3YA14
Position
927456..928211
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAASAKEFVEDVKTKIPANSKVDSVVGAPTLFLQELVEVAKGTDLK
ISAQNCFWENSGAYTGETSPAALSDLGINYVIIGHSERRDYFHETDEEINKKAKMIFSNG
MIPILCCGESLETYEDGRTVEWIEKQIKADLKSLTAGQVSSLVIAYEPIWAIGTGKSANP
EIADKICGVIRSTVEKLYDKETAESVRIQYGGSVKPENIADYMEKENIDGALVGGASLET
DSFLALLNAIK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaccaattatcgctggaaattggaaaatgaataaaacggctgcttctgcaaaa
gaatttgtagaagacgtaaaaacaaaaattcctgccaatagcaaggtagattctgttgtt
ggtgctcctaccttatttttacaagaacttgtagaagtagcaaaaggaacagatttgaaa
atctctgctcaaaattgtttctgggaaaattctggagcatatactggtgaaacatcacca
gctgcacttagtgatttaggtatcaattatgttatcattggtcactcagaacgtcgtgat
tatttccatgaaactgatgaagaaatcaacaaaaaagcaaagatgattttctctaatggt
atgatcccaattctatgttgtggggaatccttagaaacctatgaagacggtagaactgta
gagtggattgaaaaacaaatcaaagctgatttaaagagtttaacagctggtcaggtctct
tcattagtcattgcttacgaaccaatttgggcaattggaactggcaaatcggctaatccg
gaaattgcagataagatttgtggtgtcatccgttcaaccgttgaaaaattatatgacaaa
gaaacagcagaaagtgtccgtatccaatatggtggttccgtgaaaccagaaaatattgca
gattacatggaaaaagaaaatattgatggtgcattggttggtggagctagtctagaaact
gactcatttttggctctactcaatgcaatcaaataa

DBGET integrated database retrieval system