KEGG   Methylovulum psychrotolerans: CEK71_06530Help
Entry
CEK71_06530       CDS       T04929                                 

Definition
(GenBank) hypothetical protein
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mpsy  Methylovulum psychrotolerans
Pathway
mpsy00360  Phenylalanine metabolism
mpsy00362  Benzoate degradation
mpsy01100  Metabolic pathways
mpsy01120  Microbial metabolism in diverse environments
mpsy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CEK71_06530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CEK71_06530
   00622 Xylene degradation
    CEK71_06530
   00621 Dioxin degradation
    CEK71_06530
Enzymes [BR:mpsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     CEK71_06530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ASF45754
UniProt: A0A1Z4BWS4
Position
complement(1439284..1440873)
Genome map
AA seq 529 aa AA seqDB search
MPMNTLSNKTRLLDCTLRDGGYYTQWEFAADFVSEYLELVARSPIHDIEIGYRSPEKDSY
FGQYFYLSQQQLREAKQQLRPDQRLALMFNLKDVHEDSIDGFLDDIEGIVDLIRFAVAPG
EIARALRLHEKVVAHGFACALNIMHLSKWSHRVEEVLAPFQGLDNLDCLALVDSYGGCFP
EEVGRAVNLACTIFPGNVGFHGHDNAGLAFANALAALAAGGLSIDATFMGMGRGAGNLKT
ELMLTYIGIATGTEIPYFELSKFMDKMAKLHELYQWGTSLPYMYSSLSGQEQGKVMDWLI
KDRFDPSVVMGALQNKLVVQGSLDDKAFAKLADFPAATGRSRFILIGSGESARRAASTIG
HFDLDDTVILHTSLKSTDYFTDLNGHCIALSGHEIQKIPETRLHTLAQAIACWVIAPPPR
FSGSVPEIGEVCQVNPASLFLITEIADVSVPSPLQLGLTAAVECGADEVMLIGFDGYADD
GESSHAKHDENASTIADYLAVANVPYLVSLAPTLYRIPVRSLYAMVQAC
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgaataccttatcgaacaaaacgcggctactcgactgcaccttgcgtgatggc
ggctattatacccaatgggagtttgcggcggactttgtcagcgaatatttggaactggtc
gcgcgtagcccgatacacgatattgaaataggttaccgcagccctgaaaaagacagttat
tttggccagtatttttacctgtcgcaacagcagttgcgcgaagctaaacagcagttacgc
cctgaccaacgtttggcgttgatgtttaacctcaaagatgtccatgaagacagcatcgac
ggttttcttgacgatattgaagggattgttgacttgatccgctttgcggtcgcaccgggt
gaaatagcccgcgccttgcgtctgcatgaaaaagtcgtcgcccacggttttgcctgtgcc
ttgaatattatgcacttgagcaaatggagccatcgggttgaagaggtgctggcgcctttc
caagggcttgataatctggattgcctagccttagtggatagttacggcggctgttttcct
gaagaggtgggacgggcagtaaatttggcctgcaccatttttccgggtaatgtcggtttt
catggtcatgataacgcgggcttggcgtttgccaatgctttggcggccttggcggctgga
ggtttgtcgattgacgcgacgtttatggggatggggcgcggtgccggcaatctgaaaacc
gagctgatgctgacctatatcggcattgctacgggtacggaaatcccctattttgaactg
agcaagtttatggacaaaatggccaaactgcatgaactttaccaatggggaacgtctttg
ccgtatatgtattccagcttgtccgggcaggagcaaggcaaggtgatggattggctgatt
aaagaccgttttgacccatcagtggttatgggggctttgcaaaataagctggtggtgcaa
ggcagtctggacgacaaagcttttgctaagctggcggattttccggcagcaacaggccgt
agccgtttcattttgatcggcagtggtgaaagtgcgcggcgggcggcctcgactatcgga
cattttgatttggatgatactgttattttacataccagccttaaatcgacggattatttc
accgatttaaatgggcattgtattgccctgtccggccatgaaatccaaaagatacccgaa
acgcgcctgcatactttggcacaagccattgcttgctgggtgatcgccccaccgccgcgt
ttttcgggcagtgttcccgaaatcggtgaagtgtgccaagtgaacccggcatccctgttc
ctgattacggagattgccgacgtttccgtgcctagccccttgcaattggggttaacagca
gcggtcgaatgcggggctgatgaagtcatgctgataggttttgacggctatgctgatgat
ggggagtcttcccatgccaaacatgatgaaaatgccagcactattgccgattatttggcg
gtcgccaacgtcccgtatttagtcagccttgcgccgaccttataccgcattccggtacgg
tcgctgtatgcgatggtacaagcctgttaa

DBGET integrated database retrieval system