KEGG   Methylibium petroleiphilum: Mpe_A0476Help
Entry
Mpe_A0476         CDS       T00470                                 

Definition
(GenBank) quinoprotein alcohol dehydrogenase
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mpe_A0476
Enzymes [BR:mpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     Mpe_A0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Motif
Other DBs
NCBI-ProteinID: ABM93438
UniProt: A2SCZ9
Position
complement(515914..517770)
Genome map
AA seq 618 aa AA seqDB search
MSKHPVRHALSVAAALAVLGLSQGAHAVKNVTWEDISNDDRTSTDVLSYGLGLKAQRYSP
LKQISTANVQKLVPAWSHSFGGEKQRGQEGQVLVHDGVIYATSSYSRFTALDAKTGRQLW
TYEHRLPDDIRPCCDVVNRGPAIYGDKVYFGTLDARVVALDRATGKVVWNEKFGDHKVGY
TMTGAPFIVKDKKSGRVLLIHGSSGDEFGVVGWLFARDPDTGAEVWARPMVEGHMGRLNG
KDSTVTGDAKAPSWPRDKDGKLVEAWHQGGGAPWQTASFDAENNTIVIGTGNPAPWNTWK
RTKEGDDPRNWDSLFTSGQAYVDASTGELKGFFQHTPNDAWDFSGNNSIVLFEYKDPKSG
KLVKAGAHADRNGFFFVTDREKLATGAGYPNKPTALLGAWPFVDGITWAKGFDLKTGKPI
ENNNRPPAPKPGADKGESIFVSPPFLGGTNWMPMSYSPDTGLFYIPANHWAMDYWTEHLT
YKAGSAYLGQGFRIKRLYEDHVGTLRAIDPVTGKIAWEHKEKLPLWAGTMTTAGGLLFTG
TSDGYVKAFDSKTGKELWKFQTGSGVVSVPVTWEQDGEQYVGIQSGYGGAVPLWGGDMAE
MTKKVTQGGSMWVFKLPK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcatcccgtccgtcacgccctgtccgtcgcagcggcgctggccgtcctggga
ctgtcccagggtgcgcacgccgtcaagaacgtcacctgggaagacatctcgaacgacgac
cgcacgagcaccgacgtcctgagctacggtctgggcctgaaggcccagcgctacagcccg
ctgaagcagatatcgaccgccaacgtgcagaagctcgtcccggcatggagccactccttc
ggcggcgagaagcagcgcggccaggaaggccaggtgctggtgcatgacggcgtgatctac
gcgaccagttcctactctcgcttcacggcgctcgacgcgaagaccggccggcagctgtgg
acctacgaacaccgcctgcccgacgatatccgtccgtgctgcgacgtcgtcaaccgcggc
cccgccatctacggcgacaaggtctacttcggtacgctcgacgcacgcgtcgtggcgctg
gaccgcgccaccggcaaggtggtgtggaacgagaagttcggtgaccacaaggtgggctac
acgatgaccggcgcgcccttcatcgtgaaggacaagaagtccggtcgcgtgctgctgatc
cacggctcgtcgggcgacgagttcggcgtcgtcggatggctgttcgcacgcgatcccgac
accggcgccgaggtctgggctcgcccgatggtcgagggccacatgggccgcctgaacggc
aaggacagcacggtgaccggcgatgcgaaggccccctcgtggccgcgtgacaaagacggc
aagctggtcgaggcgtggcaccagggcggcggcgcgccgtggcagaccgcgtcgttcgat
gccgagaacaacaccatcgtgatcggcaccggcaacccggcgccgtggaacacctggaag
cgcacgaaggaaggcgacgacccgcgcaactgggacagcctgttcacctcgggtcaggcc
tacgtcgatgcgtcgaccggcgaactcaagggcttcttccagcacacgccgaacgatgcc
tgggacttctcgggcaacaactcgatcgtgctgttcgagtacaaggacccgaagtccggc
aagctggtgaaggccggcgcgcatgccgaccgcaacggctttttcttcgtgaccgaccgc
gagaagctcgcgaccggcgccggctatccgaacaagccgaccgcgctgctcggtgcgtgg
ccgttcgtcgacggcatcacctgggccaagggtttcgacctgaagaccggcaagccgatc
gagaacaacaaccgtccgccggcccccaagcccggcgccgacaagggcgagtcgatcttc
gtgtcgccgccgttcctgggcggcaccaactggatgccgatgagctacagcccggacacc
ggcctgttctacatcccggcgaaccactgggcgatggactactggaccgagcacctgacc
tacaaggccggctcggcctacctcggccagggcttccgcatcaagcggctgtacgaggac
cacgtcggcacgctgcgggcaatcgacccggtgaccggcaagatcgcgtgggaacacaag
gagaagctgccgctgtgggccggcacgatgacgacggccggcggcctgctgttcaccggc
acctccgacggctacgtgaaggccttcgacagcaagaccggcaaggaactgtggaagttc
cagaccggctcgggcgtggtctcggtcccggtgacctgggagcaggacggcgagcagtac
gtcggcatccagtcgggctacggcggcgccgtgcccctgtggggcggtgacatggccgag
atgaccaagaaggtcacgcagggcggctcgatgtgggtcttcaagctgcccaagtag

DBGET integrated database retrieval system