KEGG   Methylibium petroleiphilum: Mpe_A0713Help
Entry
Mpe_A0713         CDS       T00470                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00010  Glycolysis / Gluconeogenesis
mpt00260  Glycine, serine and threonine metabolism
mpt00680  Methane metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01130  Biosynthesis of antibiotics
mpt01200  Carbon metabolism
mpt01230  Biosynthesis of amino acids
Module
mpt_M00002  Glycolysis, core module involving three-carbon compounds
mpt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpe_A0713
  Energy metabolism
   00680 Methane metabolism
    Mpe_A0713
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpe_A0713
Enzymes [BR:mpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mpe_A0713
Membrane trafficking [BR:mpt04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mpe_A0713
Exosome [BR:mpt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mpe_A0713
  Exosomal proteins of melanoma cells
   Mpe_A0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABM93675
UniProt: A2SDN6
Position
complement(741241..741984)
Genome map
AA seq 247 aa AA seqDB search
MTQLVLIRHGESTWNLENRFTGWTDVELTPTGVAQAQQAGRLLKQAGIDFDTVYTSVLKR
AIWTAWHCLDGMDRTWLPVIKDWRLNERHYGGLQGLNKADMAKQFGDEQVLLWRRSYDVP
PPPLEANDPRSERSDVRYAKLAANQVPLTECLKDTVARVLPLWYGTLAPAIAAGQRLVIV
AHGNSIRALVKHLNNISDADIVGVNIPNGIPLVYDLDANLKPTSKYYLGGADAAAQAASV
SALQADG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacccaactcgtgctgatccgccacggcgaatcgacctggaacctcgagaaccgcttc
accggctggaccgatgtggaactcactcccaccggcgtggcccaggcccagcaggccggc
cggctgctgaagcaggccggcatcgatttcgacaccgtctacacctcggtgctcaagcgc
gcgatctggaccgcctggcactgcctcgacggcatggaccgcacctggctgccggtcatc
aaggactggcgcctcaacgagcgccactacggcggcctgcagggcctgaacaaggccgac
atggccaagcagttcggcgacgagcaggtgctgctctggcgccgcagctacgacgtgccg
ccgccgccgctggaagcgaacgacccgcgcagcgagcgcagcgacgtgcgctacgcgaag
ctcgcggccaaccaggtgccgctgaccgagtgcctgaaggacaccgtggcgcgcgtgctg
ccgctctggtacggcacgctggccccggccatcgccgccggccagcggctggtgatcgtg
gcgcacggcaacagcatccgcgcgctggtgaagcacctgaacaacatctccgacgccgac
atcgtgggcgtgaacatcccgaacggcatcccgctggtctacgacctggacgccaacctg
aagcccacgtcgaagtactacctgggcggggccgacgccgccgcgcaggcggcctcggtg
tccgcgctgcaggcggacggctga

DBGET integrated database retrieval system