KEGG   Methylibium petroleiphilum: Mpe_A1542Help
Entry
Mpe_A1542         CDS       T00470                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00260  Glycine, serine and threonine metabolism
mpt00750  Vitamin B6 metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01230  Biosynthesis of amino acids
Module
mpt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpe_A1542
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mpe_A1542
Enzymes [BR:mpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mpe_A1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABM94504
UniProt: A2SG15
Position
1663021..1664433
Genome map
AA seq 470 aa AA seqDB search
MNYLSTRGDSTPRGFSDILLEGLAPDGGLYLPERYPRVDAATLARWRGLSYADLAFEILS
LYITDIPADDLRTLIRKTYTREVFGTTEITPLKPLEPGVALQALSNGPTLAFKDMAMQLL
GQLFEYELARRGETLNILGATSGDTGSAAEYAMRGKQGVRVFMLSPHGRMSPFQQAQMFS
LPDANIHNLAVEGVFDDCQDIVKAVSNDLEFKRRWRIGTVNSINWARLLAQVVYYFAGYF
QATKSNDERVSFSVPSGNFGNVCAGHVARMMGLPIEQLVVATNENDVLDEFFRTGSYRVR
GAADTHETSSPSMDISKASNFERFVFDLLGRDAARTRQLFGDDIARHGGFTLTPAEFARV
REFGFVSGKSTHADRVATIRDTQQRFGVTIDPHTADGLKVGRAYVKPGTPLLVLETALPI
KFAATILEALGHEPPRPAGLEGLEQLPRRFKVMPASSATVQAYIVENCST
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctcagcacccgcggcgactccacgccgcgcggcttctccgacatcctgctc
gaaggcctggcgccggatgggggtctctacctgccggagcgctatccgcgcgtcgatgcg
gccacgctggcgcgctggcgcggcctgtcctacgccgacctcgcgttcgagatcctgtcg
ctctacatcaccgacattccggccgacgacctgcgcacgctgatccgcaagacctacacg
cgcgaggtcttcggtacgaccgagatcaccccgctgaagccgctggagcctggcgtcgcg
ctgcaggccctgtcgaacggaccgacgctcgcgttcaaggacatggccatgcagctgctg
ggccagctgttcgagtacgagctggcgcgccgcggcgaaacgctcaacatcctgggcgcg
acctccggcgacaccggcagcgcggccgagtacgcgatgcgcggcaagcagggcgtgcgc
gtcttcatgctcagtccgcacggccgcatgagcccgttccagcaagcgcagatgttcagc
ttgcccgacgcgaacattcacaacctcgcggtcgagggcgtgttcgacgactgccaggac
atcgtcaaggccgtgtccaacgacctggagttcaagcgccgctggcgcatcggcaccgtc
aactccatcaactgggcaaggctgctggcgcaggtggtgtattacttcgccggttatttc
caggccacgaagtcgaacgacgagcgggtgagcttctcggtgccatcgggcaacttcggc
aacgtgtgcgccggccatgtggcgcgcatgatgggcctgccgatcgagcagctggtggtc
gcgacaaacgagaacgacgtgctcgacgagttcttccgcaccggcagctaccgcgtgcgc
ggcgcggccgacacgcatgagacttcgagtccctcgatggacatctccaaggccagcaac
ttcgagcgcttcgtgttcgacctgctgggtcgcgacgcggcacgcacgcgccagctgttc
ggtgacgacatcgcacggcacggcggcttcacgctgacgcccgccgagtttgcgcgggtg
cgcgagttcggcttcgtgtccggcaagagcacgcacgccgaccgcgtggcgaccatccgc
gacactcagcagcgtttcggcgtgaccatcgacccgcacaccgccgacggcctgaaggtg
ggccgtgcgtacgtgaagcccggcacgccgctgctggtgctggagaccgcgctgccgatc
aagttcgccgccaccatcctcgaggcgctcggccacgagccgccccggccggccgggctc
gaggggctcgagcagctccccaggcgcttcaaggtcatgccggccagctcggcgacggtg
caggcctacatcgtcgagaattgttcgacatga

DBGET integrated database retrieval system