KEGG   Methylibium petroleiphilum: Mpe_A1600Help
Entry
Mpe_A1600         CDS       T00470                                 

Definition
(GenBank) acetoin dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00010  Glycolysis / Gluconeogenesis
mpt00020  Citrate cycle (TCA cycle)
mpt00620  Pyruvate metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01130  Biosynthesis of antibiotics
mpt01200  Carbon metabolism
Module
mpt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpe_A1600
   00020 Citrate cycle (TCA cycle)
    Mpe_A1600
   00620 Pyruvate metabolism
    Mpe_A1600
Enzymes [BR:mpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mpe_A1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Ndr PGAP1 Abhydrolase_5 Thioesterase Esterase Esterase_phd DUF915 Biotin_lipoyl_2 Lipase_3 Chlorophyllase2 DUF2048
Motif
Other DBs
NCBI-ProteinID: ABM94562
UniProt: A2SG73
Position
complement(1727397..1728512)
Genome map
AA seq 371 aa AA seqDB search
MSGITPIVMPKWGLSMSEGTVVAWLVDVGDEIEVGTPILDVETDKIANAVEAPDPGVLRR
KVASDGELLPVKALLGVMGGSDVSDADIDAYIASYVMPAADEDDEASAGPAYLYADVDGT
RIRYARKGAEDGTPVLFIHGYGGDLDNWLFNIDAVGEKSPVIALDLPGHGQSDAKLPGAS
LEALADFVARFMAVIDVAQAHVVGHSMGGAIASQLALSHPKRVASLSLIASAGLGPDINN
GYTEGFANAASRRDLKPVLEQLFKDPGLVSRQMVDDVLKYKRLDGVSEVLATLGRGLFAA
GRQASQPGLQLESTGKPVLVVWGRDDQVVPAAHAGNAPAGATVEVFDDAGHMVQMERAND
VNRLLKQHVGG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcatcactcccatcgtcatgcccaagtggggcctgtcgatgtccgaaggcacc
gtcgtcgcctggctggtcgacgtgggtgacgagatcgaggtgggcacgcccatcctcgac
gtggaaaccgacaagatcgccaacgcggtcgaggcgccggaccccggcgtgctgcgccgc
aaggtggccagcgacggcgaactgctgccggtgaaggcgctgctcggcgtgatgggcggc
agcgacgtcagcgatgccgacatcgacgcctacatcgcgtcctacgtgatgcccgcggca
gacgaggacgacgaagccagcgccggcccggcctacctgtacgccgatgtcgacggcacc
cgcatccgctacgcccgcaagggtgcggaagacggcaccccggtgctgttcatccacggc
tacggcggcgacctggacaactggctgttcaacatcgacgccgtcggcgagaagagcccc
gtgatcgcgctcgacctgccgggtcacggccagtcggacgccaagctgccgggtgcgagc
ctcgaggcgctggcggacttcgtggcgcgcttcatggccgtgatcgacgtggcgcaggcg
cacgtggtcggccactcgatgggcggcgcgatcgcctcccagctggcgttgtcgcacccg
aagcgcgtggcctcgctgagcctgatcgccagcgccggcctcggcccggacatcaacaac
ggctacaccgagggcttcgccaacgccgcatcgcgccgtgacctgaagccggtgctggag
cagttgttcaaggacccggggctggtgagccgccagatggtcgacgatgtgctgaagtac
aagcgcctcgacggcgtgagcgaggtgctggccacgctgggtcgcggtctgttcgcggcc
gggcgccaggcgtcgcagcccggtctgcagctcgagtcgaccggcaagccggtgctcgtg
gtctggggtcgcgacgaccaggtggtgccggcggcccatgccggcaacgccccggccggc
gcgacggtggaggtgttcgacgacgccggccacatggtccagatggaacgggccaacgac
gtcaaccggctgctcaagcagcatgtgggcggctga

DBGET integrated database retrieval system