KEGG   Methylibium petroleiphilum: Mpe_A1652
Entry
Mpe_A1652         CDS       T00470                                 

Definition
(GenBank) hypothetical protein
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpt02000]
    Mpe_A1652
Transporters [BR:mpt02000]
 Other transporters
  Pores ion channels [TC:1]
   Mpe_A1652
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: ABM94614
UniProt: A2SGC5
Position
complement(1782073..1783368)
AA seq 431 aa
MNPRTRTRARLLRAGATAAVAVFSIAVQAQPASTSVAPAAPQTAAASLSLRQVFDAAWAR
QPEAMALQARRNAVRAQQSAATAWTPEPAALEISNKTDRLNRNQGARELEVGVAVPLWLP
GERGRSAALAEAEGAAIESRATAAQLRVAATVREAWWQWQRARIEVDSARDQLDNTRRIA
ADVARRTRAGDLARADQHQADGAVASAEANMAQAEAGLAAARQHLRALTGTAPATSEAAA
SAAEPDPGMAATDMEAHAALLELKDRAAVAERTAALASTQSRANPELMLATTRDRGAFGE
AAQQTITLGVRIPFGGGPRHDARTANARAEATEVQAQLALERERVIAEREAAKVRVDASR
AQLAAAERRAQLARESRGFFDKSFRLGETDLPTRLRIEAEATEAERQAARTRIELAAAIS
AWRQALGLLPQ
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaatccaagaactcgaacaagggccaggctgctgcgcgcgggtgcgacggctgccgtg
gccgtcttcagcatcgccgtgcaggcgcagcccgcctctacatcggttgcgccggcagcg
ccccagactgccgcggcctccctgagcctgcggcaggtcttcgacgccgcctgggcccgc
cagcccgaggccatggccctgcaggcgcggcgcaacgccgtgcgtgcgcagcagagcgcg
gcgacagcctggacgccggaacccgcagccctggaaatctcgaacaagaccgaccgcctg
aaccgcaaccaaggtgctcgagaactcgaggtcggtgtcgccgtgccgctctggctgccc
ggtgagcgtggcaggagcgcagcactcgcggaagcagaaggtgcggcgatcgagagccgc
gccactgcagcgcaactgcgcgttgccgcgaccgtccgcgaggcgtggtggcagtggcaa
cgagcgcgcatcgaagtcgacagcgcccgcgaccagctcgacaacacccgccgcatcgct
gccgatgtggcccggcgcacaagagccggcgacctagcccgcgccgaccagcaccaggcc
gacggcgccgtggcaagtgccgaggcgaacatggcccaggccgaagccggcctcgcagcg
gcccggcagcatctgcgggcgctgactggaaccgcgccagcgacgagcgaagcggcggcc
tccgcggcagagcccgaccccggcatggccgcgaccgacatggaggcccacgccgcgctg
ctggagctgaaggatcgcgctgccgtcgccgagcggaccgcagcgctggcctcgacacag
tcgcgcgcgaatcccgagctgatgctggcgaccacgcgcgaccgcggcgccttcggcgaa
gcagcgcagcagaccatcacgctgggcgtgcgcatccccttcggcggcggcccccgccac
gacgcccggaccgccaacgcgcgcgccgaagcgaccgaggtccaggctcaactggcgctg
gaacgcgagcgtgtgatcgcagaacgcgaggccgcaaaggtccgtgtggacgcctcccgc
gcccagcttgctgctgcggagcgccgcgcccagctcgcccgcgagtctcgcggcttcttc
gacaagtccttccgccttggcgaaaccgacctgccgactcgcctgcgcatcgaggccgag
gccaccgaggccgaacgccaggccgcgcgcacccgcatcgaactcgccgcagccatctcc
gcgtggcggcaggccctgggccttcttcctcagtga

DBGET integrated database retrieval system