KEGG   Methylibium petroleiphilum: Mpe_A1889Help
Entry
Mpe_A1889         CDS       T00470                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00630  Glyoxylate and dicarboxylate metabolism
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01200  Carbon metabolism
Module
mpt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mpe_A1889
Enzymes [BR:mpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mpe_A1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABM94847
UniProt: A2SH08
Position
complement(2023635..2024951)
Genome map
AA seq 438 aa AA seqDB search
MSQPTREQQIAALEKDWAENPRWKGLKRGYSAADVVRLRGSLQPEYTIAKRGAEKLWAQC
NGASKKGYVNAFGAITAGQAMQQAKAGVEAVYLSGWQVAADGNTSETMYPDQSLYAYDSV
PTMVRRINNTFKRADEIQWSRGTGPGDKDFIDYFLPIVADAEAGFGGVLNAFELMKNMIA
AGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEACEKLIAARFAADVMGVSTIVLARTDAEA
ANLITSDHDANDKPFLTGERTQEGFYRVKNGLEQAISRGVAYAAYADLVWCETGTPDLGF
AREFAQAVHAKHPGKLLSYNCSPSFNWKKNLDDKTIAVFQEKLSELGYKYQFITLAGIHI
NWYNTFQFAQAYAKGEGMKHYVEMVQEPEFKAREQGYTFVSHQQEVGAGYFDDVTTVIQG
GSSSVKALTGSTEEEQFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaccgacccgtgaacaacagatcgccgccctcgagaaagattgggcggagaac
ccgcgctggaaaggcctgaagcgcggctacagcgctgccgacgtggttcgcctgcgcggc
agcctgcagcccgagtacacgatcgccaagcgcggcgccgaaaagctgtgggcacagtgc
aacggcgcgtcgaagaagggctacgtcaatgccttcggcgcgatcaccgccggtcaggcg
atgcagcaggccaaggccggcgtcgaggccgtgtatctgtcaggctggcaggttgccgcc
gacggcaacacctccgagaccatgtatcccgaccagtcgctgtacgcctacgactcggtg
ccgaccatggtccgccgcatcaacaataccttcaagcgcgccgacgagatccagtggtcg
cgcggcacgggccccggcgacaaggacttcatcgattacttcctgccgatcgtggccgat
gcggaagccggcttcggcggcgtgctgaacgccttcgaactgatgaagaacatgatcgcc
gcgggcgccgccggcgtgcacttcgaggaccagctcgccgcagtgaagaagtgcggccac
atgggtggcaaggtgctggtgccgacccaggaagcctgcgagaagctgatcgccgcgcgc
ttcgccgccgacgtgatgggcgtgtcgaccatcgtgctggcccggaccgatgccgaggcc
gccaacctgatcaccagcgaccacgacgccaacgacaagccattcctgaccggcgaacgc
acccaggaaggcttctaccgcgtgaagaacggcctggagcaggccatcagccgcggtgtt
gcctacgccgcctacgctgacctcgtgtggtgcgagaccggcacgccggacctgggattc
gcccgtgagttcgcgcaggccgtgcatgccaagcacccgggcaagctgctgagctacaac
tgctcgccgtcgttcaactggaagaagaacctggacgacaagacgatcgccgtgttccag
gagaagctctcggagctgggctacaagtaccagttcatcaccctcgcaggcatccacatc
aactggtacaacaccttccagttcgcccaggcctatgcgaagggcgagggcatgaagcac
tacgtcgagatggtgcaggagcccgagttcaaggcgcgcgagcagggctacaccttcgtg
tcgcaccagcaggaagtcggcgccggctacttcgacgacgtcaccacggtgattcagggc
ggctcgtccagcgtcaaggcgctgaccggctcgaccgaggaagagcagttccactga

DBGET integrated database retrieval system