KEGG   Methylibium petroleiphilum: Mpe_A2198Help
Entry
Mpe_A2198         CDS       T00470                                 

Definition
(GenBank) selenophosphate synthase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00450  Selenocompound metabolism
mpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Mpe_A2198
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpt03016]
    Mpe_A2198
Enzymes [BR:mpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Mpe_A2198
Transfer RNA biogenesis [BR:mpt03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Mpe_A2198
 Prokaryotic Type
    Mpe_A2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ABM95154
UniProt: A2SHW5
Position
complement(2353150..2354319)
Genome map
AA seq 389 aa AA seqDB search
MVERELGRRAHVDHGVEAGEVVDGSRAVAHRRAARFGLIDTCIMESIRLTSFSHGGGCGC
KIAPGVLADILSRAPAGLIPPDLLVGTETADDAAVYRLNEHQALVATTDFFTPIVDEPYD
FGRIAATNAISDVYAMGGTPILALALVGMPLDKLPPAVIGRILEGGASVCREAGIPIAGG
HSIDVLEPIYGLVALGLVHPERVRRNADARPGDVLVLGKPLGVGVLSAALKKGRLDAAGY
AEMLRLTTQLNRVGSELGALDGVHAMTDVTGFGLAGHLLEVCRGSGLAAEVDLASVPWID
IARGFAQEGIVTGASARNWAGYGDHVDLGPQVEPWQRALLSDPQTSGGLLVSCAPGAVDA
VLAAFWRAGFAAAASIGRLQSGAARVRFA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgagcgcgaactcggccggcgagcgcacgtcgatcacggtgtcgaagccggcgag
gtcgtcgacggtagtcgggcagtggctcaccgtcgggccgcccgattcggtttgatcgac
acttgcatcatggaatccatccgactcacatccttttcccacggtggcggctgcggctgc
aagatcgcgcccggggtgctggccgacatcctgtcgcgtgccccggccgggctgatccca
cccgacctgctggtcggcaccgagacagccgacgacgcggcggtctaccgactcaacgag
caccaggcgctggtggccaccaccgatttcttcacgccgattgtcgacgagccctacgac
ttcggccgcatcgcggccaccaacgcgatctccgacgtctatgcgatgggcggcacgccg
atcctggccctggccctggtcggcatgccgctggacaagctgccgcccgcggtgatcggc
cgcatcctggagggcggcgcgagcgtgtgccgcgaggccggcatcccgatcgccggcgga
cactcgatcgacgtgctcgagccgatctacggcctggtcgcgctgggcctggtgcacccc
gagcgcgtgcgccgcaatgccgacgcccggccgggcgacgtgctggtgctcggcaagccg
ctcggcgtgggagtgctgtcggcggcgttgaagaagggccgcctcgacgcggccggctat
gccgagatgctgcgcctcaccacgcagctcaatcgcgtgggcagcgaactcggtgcgctg
gacggcgtgcacgcgatgaccgacgtgaccggcttcggcctcgcgggccacctgctggag
gtgtgccgtggctccggactggccgccgaagtcgacctggcgagcgtgccgtggatcgac
atcgcgcgaggcttcgcgcaggaaggcatcgtcaccggcgcctcggcacgcaactgggcc
ggctacggcgaccacgtcgatctcggcccgcaggtcgagccctggcagcgtgcgctgctc
agcgatccgcagacgagcggcgggttgctggtgtcgtgtgcgccgggcgccgtcgacgcg
gtgctggccgcgttctggcgcgccggcttcgcggcggccgcatccatcggtcggctgcag
tccggcgccgcgcgcgtgcggttcgcatga

DBGET integrated database retrieval system