KEGG   Methylibium petroleiphilum: Mpe_A2389Help
Entry
Mpe_A2389         CDS       T00470                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mpt  Methylibium petroleiphilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 TraL PrgI
Motif
Other DBs
NCBI-ProteinID: ABM95344
UniProt: A2SIF5
Position
2553443..2553853
Genome map
AA seq 136 aa AA seqDB search
MTVPSESPHDTLVTFLPHRLNRQPVVVRGLTADELWICAGLSAAAGFALGLPLAWLTHSI
AMVPTLIVAGIALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRHPALAALLGGQRLIT
RSGYWTTRRNTNRGAP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcccttcggagagcccgcacgacacgctggtgaccttcctgccgcaccgactg
aatcgccagccggtggtcgtgcgcgggctgaccgccgacgagttgtggatctgcgccggc
ctgtcggccgcagccgggttcgcgctcggcctgcccttggcctggctcacgcacagcatc
gccatggtgcccacgctgatcgtcgccggcatcgcgctgggcgtctttgtcggcggaggc
ttcctgcgcgcgcagaagcgcggccggcccgacacctggctgtaccggcagctccaatgg
cggttggccctgcggcatccggcgctggcggcgctcctgggcgggcagcgcctcatcacc
cgctcgggctactggactacccggcgcaacaccaatcgaggggcgccatga

DBGET integrated database retrieval system