KEGG   Methylibium petroleiphilum: Mpe_A2399
Entry
Mpe_A2399         CDS       T00470                                 
Name
(GenBank) conserved hypothetical protein
Organism
mpt  Methylibium petroleiphilum
SSDB
Motif
Pfam: DivIC
Other DBs
NCBI-ProteinID: ABM95354
UniProt: A2SIG5
Position
2563193..2564599
AA seq 468 aa
MNASLPDFLRRAKSPLRATLLVAAITLVVGVAWAQTRIDPNGVNVSGSVIGDDVLYSIGG
GRAVSMGGAGNMQSIGVGVGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSNVIQNATS
AVASLPALIIQRADPGLYNLLTNGILQARLDFDRSKMTCRAIANRMADMAGGQAGWDQLA
EGMALRDAVSSTDAVSAIEQAESNKGNNGVPWVGGGNAGGSGQSSIKVVGDVTRAGYNLL
NGRNATDTSSIARSACGNRLTCQTWSSPQAAADWATRVLGEREQRTCENCTKTQTTPGVG
LTPMIQEEYETKLQALQELVTGARPTTLANLDAAGSSSLPITRGVIEALRDEPDQDVLGR
RLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIIQRHSTRAAGSRGVFEGDTTRDRLREIQKPRSGTP
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaacgcctccctccctgactttctgcgccgcgcgaagtcgcccctgcgggccacgctg
ctcgtggcggccatcacgctggtcgtcggcgtcgcctgggcgcagacccgcatcgacccc
aatggcgtgaacgtcagcggcagcgtgatcggcgacgacgtgctctacagcatcggcggc
ggccgggccgtgtcgatgggtggtgccggcaacatgcagagcatcggcgtcggcgtcggc
tggaacagcaacctgatctgcggcgacatgagcatcaccacgacgctgcagaaccagctc
aacggcatcaccaacggcttccagacgatcatgagcaacgtgatccagaatgccaccagc
gccgtggcctcgctgccggccctgatcatccagcgcgccgacccgggtctctacaacctg
ctgaccaacggcatcctccaggcgcgcctggacttcgaccgctcgaagatgacctgccgg
gccatcgccaatcggatggcggacatggccggcggccaagccggctgggaccagctcgcc
gaggggatggcgctgcgggatgcggtcagcagcaccgatgccgtctccgccatcgagcag
gccgagtccaacaaagggaacaacggcgtgccctgggtcggcggcggcaacgcgggcggc
tccggccagagttcgatcaaggtggtcggcgacgtgacgcgcgcgggctacaacctgctc
aacgggcgcaacgccaccgatacctcgtcgatcgcgcgcagcgcctgcggcaaccgcctg
acctgccaaacctggtcctcgccccaggcggccgccgactgggcgacccgcgtgttgggc
gaacgcgagcaacgcacctgcgaaaactgcacgaagacccagaccacgcctggcgtcggg
ctcacgccaatgatccaggaggagtacgagaccaagctgcaggcgctgcaggaactggtg
acgggcgcccggccgacgacgttggccaatctcgacgcagccggcagcagctcgctgccg
atcacccgcggcgtgatcgaggccctgcgtgacgaacccgaccaggacgtgctgggccgg
cgcctcgcgtccgaggctgcgctgtccagcgtgctggagaaggccctgctgctgcaacgc
acgttgctgaccggcaagaaggagccgaacgtcgctgccaacgagctggccgtgcaggcg
gtcgaccaggagaacagcgcgctggagcaggagatcaacaacctcaagaccgagctggaa
ctgcggcgcacgctggccggcaactcggcgatggcgatcatccagcgccacagcacccgc
gctgccggctcgcgcggcgtcttcgagggcgacaccacgcgcgaccgtctgcgggaaatc
cagaagccgcggagcggtacgccatga

DBGET integrated database retrieval system