KEGG   Methylibium petroleiphilum: Mpe_A3022Help
Entry
Mpe_A3022         CDS       T00470                                 

Definition
(GenBank) regulatory inactivation of DnaA Hda protein
  KO
K10763  DnaA-homolog protein
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mpt03032]
    Mpe_A3022
DNA replication proteins [BR:mpt03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    Mpe_A3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA AAA_16 IstB_IS21 AAA_30 NACHT AFG1_ATPase AAA_22 AAA_18 ABC_tran AAA TsaE RNA_helicase AAA_25 DUF815 AAA_33 Zeta_toxin Sigma54_activ_2 Adeno_IVa2 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ABM95975
UniProt: A2SK86
Position
complement(3213781..3214461)
Genome map
AA seq 226 aa AA seqDB search
MKQLPLQLGPGPAQSFENFAVGANAAAVGAVRAASASPTPLYLWGPAGAGKSHLLRALAR
EAAVQGRRVGAFGPSLETPWTWGEGVDLVLLDGCDDFDAARQHAAFALFVEAATHRVPVV
AAGRLPPVDLPVREDLRTRLGWGPVFQLLPLAEAEMRVTLQREAGRRGIALSDDVTGYLL
TRFARDLGSLMALLDALDEFALSEQRAVTVPLLKRMLAEQTTKEGA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgcccttgcagctcgggcccggcccggcgcagagcttcgagaacttcgcg
gtgggcgccaatgcggcggccgtcggcgccgtgcgcgcggcatcggcctcgccgaccccg
ctctacctgtgggggccggccggtgccggcaagtcccacctgctgcgtgcgctggcccgc
gaggcggcggtgcagggccggcgcgtcggtgccttcggtccgtcgctcgagacgccctgg
acctggggcgaaggcgtcgacctggtgctgctcgacggctgcgacgacttcgacgctgcc
cggcagcacgccgccttcgcgctgttcgtcgaggccgcgacgcaccgtgtgccggtggtc
gcggccgggcgcctgccgccggtcgacctgccggtgcgcgaggacctgcgcacgcgcctg
ggctgggggccggtgttccagctgctgccgctcgccgaggcggagatgcgcgtcacgctg
cagcgcgaggcaggccgccgcggcatcgcgctgtcggacgacgtgacgggctatctactg
acccgtttcgcgcgtgatctcggctcgctgatggcgctgctggacgcgctggacgaattt
gcgctcagcgagcagcgcgcggtcaccgtgcccctgctcaagcgcatgctggccgagcag
accacgaaggaaggtgcatga

DBGET integrated database retrieval system