KEGG   Methylibium petroleiphilum: Mpe_A3367Help
Entry
Mpe_A3367         CDS       T00470                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpt  Methylibium petroleiphilum
Pathway
mpt00071  Fatty acid degradation
mpt00072  Synthesis and degradation of ketone bodies
mpt00280  Valine, leucine and isoleucine degradation
mpt00310  Lysine degradation
mpt00362  Benzoate degradation
mpt00380  Tryptophan metabolism
mpt00620  Pyruvate metabolism
mpt00630  Glyoxylate and dicarboxylate metabolism
mpt00640  Propanoate metabolism
mpt00650  Butanoate metabolism
mpt00900  Terpenoid backbone biosynthesis
mpt01100  Metabolic pathways
mpt01110  Biosynthesis of secondary metabolites
mpt01120  Microbial metabolism in diverse environments
mpt01130  Biosynthesis of antibiotics
mpt01200  Carbon metabolism
mpt01212  Fatty acid metabolism
mpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpe_A3367
   00630 Glyoxylate and dicarboxylate metabolism
    Mpe_A3367
   00640 Propanoate metabolism
    Mpe_A3367
   00650 Butanoate metabolism
    Mpe_A3367
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mpe_A3367
   00072 Synthesis and degradation of ketone bodies
    Mpe_A3367
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mpe_A3367
   00310 Lysine degradation
    Mpe_A3367
   00380 Tryptophan metabolism
    Mpe_A3367
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mpe_A3367
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mpe_A3367
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mpe_A3367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpt04147]
    Mpe_A3367
Enzymes [BR:mpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mpe_A3367
Exosome [BR:mpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mpe_A3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABM96320
UniProt: A2SL81
Position
complement(3577425..3578609)
Genome map
AA seq 394 aa AA seqDB search
MSTDDPVVIVSAARTPIGGLLGDLAALAAWELGAVAIRAAVERAGVPGDAVDEVLMGNCL
MAGQGQAPARQAARKAGLPDSAGAVTLSKMCGSGMRALMFGHDMLAAGSAEVVVAGGMES
MTNAPHLSFVRKGLKYGAAVLYDHMALDGLEDAYERGKSMGVFAEQCVSYYSFRREAMDA
FAVASTQRAIAAHNDGSFDWEIAPVTLAGRAGDVTVDRDEQPFKAKLDKITALKPAFGKD
GTITAATSSSISDGAAALVLMRASTARARGLAPIAVLRAHAVHAQAPAWFSTAPAGAIRK
VLQKTGWSVRDVDLWEINEAFAAVTMAAMTDFELPHERVNVHGGACALGHPIGASGARIV
VTLLGALQRRGLRRGVAALCIGGGEATALAVELP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgatgatccggtcgtgatcgtgtcggctgcgcgaacgccgatcggcgggttg
ctcggcgacctggcggcgctggcggcctgggaactgggcgccgtcgcgatccgcgccgcg
gtcgaacgcgccggcgtgccgggcgacgccgtcgacgaggtgctgatgggcaattgcctg
atggcgggccagggccaggcgccggcccgccaggcggcgcgcaaggccggccttccggac
tcggccggcgcggtgacgctgtcgaagatgtgcggctccggcatgcgcgcgctgatgttc
ggccatgacatgctggcggccggctcggccgaggtggtggtggccggcggcatggagagc
atgacgaacgcaccgcacctgagcttcgtgcgcaaggggctgaagtacggcgcggcggtg
ctgtacgaccacatggcgctcgacggcctggaggacgcctacgagcgcggcaagtcgatg
ggcgtattcgccgaacagtgcgtcagctattacagcttccggcgcgaggcgatggacgcg
ttcgcggtggcgtcgacgcagcgcgcgatcgcggcccacaacgacggcagcttcgactgg
gagatcgcgccggtcacgctggccggcagggcgggcgacgtgaccgtcgaccgcgacgag
cagcccttcaaggccaagctcgacaagatcacggcgctgaagccggccttcggcaaggac
ggcacgatcaccgccgccacctcgtcgagcatctccgacggcgccgcggcgctggtgctg
atgcgtgcctccaccgcccgcgcgcgcggcctcgcgccgatcgccgtgctgcgcgcgcac
gcggtgcatgcgcaggcgccggcctggttctccaccgcgccggccggcgcgatccgcaag
gtgctgcagaagaccggctggtcggtgcgcgacgtcgacctgtgggagatcaacgaggcc
ttcgccgcggtgacgatggcggcgatgaccgatttcgagctgccgcacgagcgtgtcaac
gtgcacggcggggcctgcgcgctgggccacccgatcggcgcgtcgggggcccgcatcgtc
gtgacgctgctgggcgcgctgcagcggcgcgggctgcggcgtggcgtggcggcgctgtgc
atcggcggcggcgaggccacggcactggcggtcgagctgccttga

DBGET integrated database retrieval system