KEGG   Methylibium petroleiphilum: Mpe_B0370Help
Entry
Mpe_B0370         CDS       T00470                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K12069  conjugal transfer pilus assembly protein TraA
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpt02044]
    Mpe_B0370
Secretion system [BR:mpt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Mpe_B0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: ABM97145
UniProt: A2SNK6
Position
RPME01:319626..319937
Genome map
AA seq 103 aa AA seqDB search
MKFNLSTLSKRRLAVAAAALALAGVAVAGTATTGTNDFNSVTTRLTAWLEGSLGKTFALG
SLGVGLAIGVVKQSVMSVVTGVAVALAGSIGPAVLGGIFTATM
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaatctctccaccctgtccaagcgtcgcctcgcggttgccgctgccgccctg
gccctcgccggtgtcgctgtcgccggcaccgcgacgaccggtaccaacgacttcaactcc
gtgacgacgcgcctgaccgcctggctcgaaggctcgctgggcaagacgttcgccctcggg
tcgctcggcgtcggcctggccatcggcgtcgtgaagcagtcggtcatgtcggtggtcacc
ggtgtggctgtcgcgctggcgggctcgatcggcccggccgtgctcggcggcatcttcacg
gcgacgatgtaa

DBGET integrated database retrieval system