KEGG   Methylibium petroleiphilum: Mpe_B0554
Entry
Mpe_B0554         CDS       T00470                                 

Definition
(GenBank) putative iron-sulfur oxidoreductase subunit
  KO
K21324  tert-butyl alcohol monooxygenase/tert-amyl alcohol desaturase reductase
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    Mpe_B0554
SSDB
Motif
Pfam: Fer2 NAD_binding_1 Fer2_4
Other DBs
NCBI-ProteinID: ABM97324
UniProt: A2SP35
Position
RPME01:complement(501308..502321)
AA seq 337 aa
MYQLSHTGKYPKTALNLRVRQITYQGIGINAYEFVREDGGELEEFTAGAHVDLYFRDGRV
RQYSLCNDPAERRRYLIAVLRDDNGRGGSIAIHERVHTQRLVAVGHPRNNFPLIEGAPHQ
ILLAGGIGITPLKAMVHRLERIGADYTLHYCAKSSAHAAFQEELAPLAAKGRVIMHFDGG
NPAKGLDIAALLRRYEPGWQLYYCGPPGFMEACTRACTNWPAEAVHFEYFVGAPVLPAEG
VPHDIGSDALALGFQIKIASTGTVLTVPNDKSIAQVLGEHGIEVPTSCQSGLCGTCKVRY
LAGDVEHRDYLLSAEARTQFLTTCVSRSKGATLVLDL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtatcagttgagtcacaccggcaagtacccgaagacggcgctgaacctgcgggtccgg
cagatcacctaccaggggatcggcatcaacgcctacgaattcgtgcgcgaggacggcggc
gaactggaggagttcaccgccggggcccacgtggatctgtacttccgcgacggacgcgtg
cgacagtattcgttgtgcaacgaccccgccgagcgtcggcgatacctgatcgcggtgctg
cgcgacgacaatgggcgcgggggttccatcgcgatccacgaacgcgtgcacacgcaacga
ctcgtcgcggtcggacacccgcgcaacaacttcccgctgattgagggggcgccccaccag
atcctgctggccggcggcatcggcatcacgccgctgaaggccatggtgcatcggttggaa
aggataggcgcggactacaccctgcactactgcgcgaagtcgagcgcccacgcggcgttc
caggaggaactcgcgccgctggccgccaaggggcgcgtgatcatgcacttcgacggcggc
aatccggccaagggcctcgacatcgcggcgctgctgcggcggtacgagccgggttggcag
ctctactactgcggcccccccgggttcatggaggcctgcacacgtgcctgcaccaattgg
cccgccgaggcggtgcacttcgagtacttcgtcggcgcgccggtgcttcccgccgaggga
gtcccccacgacatcggcagcgatgcgctggcgctcgggttccagatcaagatcgccagc
acgggaacggtcctgacggtaccgaacgacaagtcgatcgcgcaggtgcttggcgagcac
ggcatcgaagtaccgacatcatgccagagcggcctgtgcggtacgtgcaaggtccgctat
ctcgcgggcgacgtcgagcatcgggattacttgctgtccgccgaggcacgcacgcagttc
ctgaccacctgcgtgtcgcgctcgaagggcgcgacgctggtcctggatctttga

DBGET integrated database retrieval system