KEGG   Mycoplasma pulmonis: MYPU_6590
Entry
MYPU_6590         CDS       T00055                                 

Gene name
MYPU_6590
Definition
(GenBank) PROTEIN-EXPORT MEMBRANE PROTEIN SECD
  KO
K12257  SecD/SecF fusion protein
Organism
mpu  Mycoplasma pulmonis
Pathway
mpu02024  Quorum sensing
mpu03060  Protein export
mpu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mpu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    MYPU_6590 (MYPU_6590)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MYPU_6590 (MYPU_6590)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MYPU_6590 (MYPU_6590)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpu02044]
    MYPU_6590 (MYPU_6590)
Secretion system [BR:mpu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   MYPU_6590 (MYPU_6590)
SSDB
Motif
Pfam: SecD_SecF RIFIN
Other DBs
NCBI-ProteinID: CAC13832
UniProt: Q98PR0
Position
complement(790985..793606)
AA seq 873 aa
MNMKEFFKKIFSLTNPKRWFIVFLITITTVLSVSIGSSLYVAPNVNKSIDYGGGIESLIQ
VRNAKGENADENLTSQVSNSLHQRLTGGAGVNGSNVSVEGGGKIRISSTGVSSDDDKKKF
EDSIVKKPSLILTDVNSNPIFQDGFFNPNIRLDYSKPEEIEWHRYVAPIKESSARDLPDP
SRPGNSIVQIGLKNQDAITEFAKATDYISKSRIPTLLFWLDLKGLVEKGQLAENAADWEA
SGQRPYNFVFNGNRPFEIDRRVNRLIPNAKRESRLNVSSFLLSEANVRQALNAETFIITG
NLTASSAKQLALDVNFGSGDYTLELLSSRFVDATLGTQSFNYAIIAGIISFIVIALIMIY
NYGVLGIASSLSIGLYIFLSLTVFTWLNGEYSPATIAALVIAIGMSVDANIITFERIKQQ
LKYGDSLKKATKNAHRFSLSTILDSNITTLIVSGILFYFGTKLIRGFSISLILSIIFILF
VMLIITRMATSLLIGTGFFDNRLYLIGVGRSFFTKEKKIITFFEKLNYFKLSKWFILFFG
VFVLIAIIIYSIFAGINGNFLSGFERSLEFQGGTNISFEKSSIDNLSLAEAQEIKNTLVN
LKNTANGSENLITSGAQDIFINAKNQARSNYVVSLQTKQVFDQDQINYIIQEVSKTFSNI
SSTPFIVSTNEASSLVKNSIVSISIGIVGIVLYTIFRLKWTFSIAAIVALLHDIVFVIAF
FIIFRLEISPIFVAAILSIIGYSINDTIVTFDRIKEIMHSEYYHQKIDQKVLINITNKAI
KDTIKRSMLTTITTLVTIVVLLSFRGSTEVNFNIALFVGLISGTYSSIFIASWLFVKLET
FRQKMIRRRKANNFWSVGFVEEQTFNGINDFVS
NT seq 2622 nt   +upstreamnt  +downstreamnt
ttgaacatgaaagaattttttaaaaaaatatttagtttaactaaccctaaacgatgattt
attgtttttttaattaccataaccacagttttatctgtaagtattggttcaagtttgtat
gttgctcctaatgttaataaatcaattgactatggtggaggaattgaatcactaattcaa
gttagaaatgccaaaggtgaaaatgctgatgaaaatttaacttctcaagtttctaattcc
cttcatcaaagacttactggtggagctggtgtcaatggctcaaatgttagtgttgaaggt
gggggtaaaattagaattagtagtacaggtgtttcttcagatgatgataaaaagaaattt
gaagattcaattgtcaaaaaaccttctttaatcttaactgatgttaattctaatcctatt
ttccaagatggattttttaatcctaatataagacttgactattcaaaacctgaagaaatt
gagtgacatcgatatgtagctcctattaaagaatcctcagctagagatttacctgatcct
tcaagacctggtaattcaatagtacaaattggactaaaaaatcaagatgcaattacagaa
tttgccaaagcaactgactatatttcaaaaagtagaattccaaccttacttttttgactt
gatcttaaaggacttgtagaaaaaggtcaactagcagaaaatgcagctgattgagaagct
tcaggacaaagaccatacaattttgtctttaatggcaatagaccttttgaaatagataga
agagttaacagacttattcctaatgctaaaagagaaagtcgccttaatgtaagtagtttt
cttctttcagaggccaatgttagacaagctcttaatgccgaaacttttataattactggt
aatttaactgcctcttcagctaaacaacttgcccttgatgtaaactttggttcaggtgat
tacactttagagcttttatcttcaagatttgttgatgctactttaggaactcaatcattt
aactatgccattattgcaggaataatttcatttattgtaattgctctaattatgatttac
aactatggtgttcttggaatagcctcctctttgtccattggactttacatattcctttca
ctaactgtttttacttgattaaatggagaatactcaccagctacaatagcggctttagta
atagctataggtatgtcagttgatgccaacattattacttttgaacggattaaacagcaa
ctcaaatatggagatagtctaaaaaaagctactaaaaatgctcatagattctctctttca
acaattttggactcaaacataactactttaattgttagtggaattcttttttactttggt
acaaagctcattagaggttttagcatctcacttattctctcgataatatttattttgttt
gtgatgttaattatcactagaatggcaacttctttattaataggaacaggcttctttgac
aatagactttatttaattggtgtaggtagaagcttctttacaaaagagaaaaaaataatt
acattttttgaaaaattaaattatttcaaactttctaaatggtttattttattctttgga
gtctttgttttaatagctataattatctattcaatttttgctggaatcaatggaaatttc
ttgtcaggttttgaaagatcattagaatttcaaggtggaacaaatatctcctttgaaaaa
agttcaattgataatttatctttagctgaagctcaagaaattaaaaatactcttgtaaat
ttaaaaaacacggctaatggaagtgaaaacttaattacaagtggagctcaagatattttt
atcaatgctaaaaatcaagctagaagcaattatgtagtttctcttcaaacaaaacaagtt
tttgatcaagatcaaattaactacataatccaagaagtttcaaaaactttttcaaatatc
tcttctactccttttatagtctcaacaaatgaagcaagctcattggttaaaaattctata
gtttcaatttctattggtattgttggaatagttctttatacaatttttagattaaaatga
actttttcaatagcagcaattgttgctcttttacatgatattgtctttgtaattgctttc
tttataatatttagattagaaatttcaccaatctttgtagctgctattctttcaattatt
ggttattcaattaacgatacaattgttacttttgatcgaatcaaagaaattatgcatagt
gaatactatcaccaaaaaattgatcaaaaagtgctaatcaatattaccaacaaagccatt
aaagacactattaaaaggtcaatgcttacaacaataactactttagttaccatagttgtt
cttctatcatttagaggatcaactgaagtaaacttcaatatagctctatttgtaggttta
atttcaggaacttattcatctatttttatagcttcatgattatttgtgaaattagaaacc
tttagacaaaagatgattagaagaagaaaagcaaataacttttgaagtgttggttttgtt
gaagaacaaacattcaatggaataaatgattttgtctcttaa

DBGET integrated database retrieval system